KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_04007Help
Entry
CSK29544_04007    CDS       T03903                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
csj  Cronobacter sakazakii ATCC 29544
Brite
KEGG Orthology (KO) [BR:csj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CSK29544_04007
Enzymes [BR:csj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CSK29544_04007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 DAO NAD_binding_8 AlaDh_PNT_C K_oxygenase Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: AKE96952
UniProt: A0A2S9UF86
LinkDB All DBs
Position
complement(4147439..4149004)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLERLTKPVELVATLDDSAKSAEIKELLLEIAELSDKVSFREDNTLAA
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGAVFQNEITERNVMGVPAVFMNGVE
FGSGRMTLAEIVAKVDTGAEKRAAEELNQRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYDVDVIDTQSATKLIPAASEG
GLHQIETASGAVLKARSVIVATGAKWRNMGVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAMTTEVKGD
GTKLTGLDYQDRVTGSVKHLEVAGIFVQIGLLPNTTWLEGAVERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaacatgaaaacccagctcaaggcgtatcttgagcgtctgacaaagcct
gttgagttagtggccacgctggatgacagcgcgaaatcggcggagattaaagaactgctg
ctggaaatcgccgagctgtctgacaaagtgtccttcagggaagacaacacgctcgcggcg
cgcaaaccttcatttttgattacgaacccgggctctgaccaggggccgcgctttgcgggc
tcgccgctgggccacgaatttacctcgctggtgctggcgctgctgtggaccggcggtcat
ccgtcgaaagaagcgcaggcgctgcttgagcagatccgtgacctggacggcgatttcgag
tttgaaacctactactcgctctcctgccacaactgcccggacgtggtacaggcgctgaac
ctgatggccgtgctgaacccgcgcatcaaacatacggcgattgacggtgcggtgttccag
aatgaaatcaccgagcgcaacgtgatgggcgtgccggcggtcttcatgaacggtgtggaa
tttggttctggccgtatgacccttgccgaaatcgtcgcgaaagtggataccggcgcggaa
aaacgcgcggcggaagagctgaaccagcgcgacgcttacgatgtactgattgtcggctcc
ggcccggcgggcgcggcggcggcgatttactccgcacgtaaaggcatccgtaccggcctg
atgggcgagcgtttcggtggtcaggtgctggacaccgttgatatcgaaaactacatctct
gtgccgaaaaccgaaggccagaaactggcaggcgcgctgaaggcgcacgtggatgattac
gatgttgacgttatcgatactcaaagcgcaacgaagctgattccggcggcgagcgaaggc
ggtctgcatcagattgaaaccgcctccggcgcagtgctgaaagcgcgcagcgtgatcgtg
gcgaccggcgcgaaatggcgcaacatgggcgtgccgggtgaagatcagtatcgcaccaaa
ggcgtgacttactgcccgcactgcgacggcccgctgtttaaaggcaaacgcgtggcggtt
atcggcggcggtaactccggcgtggaagcggctatcgacctcgcggggatcgttgagcac
gtaacgctgctggaattcgcgccagaaatgaaagcggaccaggtgctgcaggataaactg
cgtagcctgaaaaacgtcgacatcatcctgaacgcgatgaccaccgaagtgaaaggcgac
ggcacgaagctgaccggtcttgattatcaggatcgcgtaacgggctcggtgaagcacctg
gaagtggcggggattttcgttcagatcggtctgctgccgaacacgacctggcttgaaggc
gctgtcgagcgtaaccgcatgggcgagattatcatcgacgccaaatgcgagaccagcgtg
aagggcgtattcgccgcgggcgactgcaccaccgtgccgtacaaacagatcattatcgcc
accggtgaaggcgcgaaagcctccctgagcgcgtttgattatctgattcgtaccaaaacc
gcataa

DBGET integrated database retrieval system