KEGG   Cronobacter sakazakii ES15: ES15_0273Help
Entry
ES15_0273         CDS       T02119                                 

Gene name
mrcA
Definition
(GenBank) penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00550  Peptidoglycan biosynthesis
csk01100  Metabolic pathways
csk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ES15_0273 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ES15_0273 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csk01003]
    ES15_0273 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csk01011]
    ES15_0273 (mrcA)
Enzymes [BR:csk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ES15_0273 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ES15_0273 (mrcA)
Glycosyltransferases [BR:csk01003]
 Polysaccharide
  Bacterial polysaccharide
   ES15_0273 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:csk01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ES15_0273 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AFJ97846
LinkDB All DBs
Position
complement(308821..311373)
Genome map
AA seq 850 aa AA seqDB search
MKFVKYLFFLAVFCILLGAGSIYGLYKFIEPQLPDVATLKDVRLQIPMQIYSADGELIAQ
YGEKRRIPLTLNQIPPEMVKAFIATEDSRFYDHHGVDPIGIFRAASVALFSGHASQGAST
ITQQLARNFFLSPERTLMRKIKEAFLAVRIEQLLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKTVDQLSLSEIAVIAGLPKAPSTFNPLYSLERATARRNVVLSRMLSEGYISQSQY
DEARSETINANYHAPEIAFSAPYLTEMVRQEMISRYGENAYEDGYKVYTTITRRIQQAAQ
KAVRDNVMDYDMRHGYRGPSNVLWRVGEVAWDSKKITDSLKNLPTYGPLLPAVVTSANPD
EATALLADNSSVSLKMDGVRWARPYRSDTAQGPTPRRVTDVLQAGQQIWVRKVDDSWWLA
QVPDVNSALVSINPKDGSILALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLASILNDVPISRWDAGAGSDWRPKNSPPEYAGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGSASFTPLQVARGYAVMANGGFLVDPWFISKITNVQG
ETLFEAKPKIACPDCDIPVIYGETPKSNVLENKDVENVATSAEQQNAPVPMPQLEQANRD
LVAQSPAPQYAPHVISTPLSFLIKSALNSNIFGEPGWQGTGWRAGRDLKRRDIGGKTGTT
NSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTTASGAIKDQISGYEGGAKSAQPAWDAY
MKAALEGVPEEPLTPPPGIVTVNIDRSTGQLANGGNSREEYFIEGTQPTQQAVHEVGTTI
IDNGETHELF
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattcttccttgcagtcttttgcattctgctgggagccggc
tcgatatacggcctgtataaatttattgagccccagttacctgacgtcgccacgctgaaa
gatgtgcggctgcaaattcctatgcagatctatagcgctgacggcgagctgatcgcgcag
tacggcgaaaagcgccgtatcccgctgacgcttaatcagatcccgccggaaatggtgaaa
gcgtttatcgccacagaagacagccgcttctacgatcaccacggcgtcgatccgatcggt
attttccgtgccgcgagcgtggcgctcttctccggtcacgcttcacagggcgcgagtacc
attacgcagcagctggcgcgtaacttctttctaagcccggaacgcaccctgatgcgtaaa
atcaaggaggcttttctcgcggtgcgtattgagcaactgctgacgaaagatgagatcctt
gagctttacctgaacaagatttatctcggttatcgcgcttacggcgtgggcgcggctgct
caggtctatttcggcaaaacggtggatcaactctccttaagcgaaatcgccgtgatagcc
ggcctgccgaaagcgccgtcaacgttcaacccgctctactcgcttgagcgcgccacggcg
cgccgtaacgtcgtgctctcacgtatgctgagcgagggctatatcagccagtcgcagtat
gacgaggcgcgcagcgaaaccattaacgccaattatcacgcgccggaaatcgcgttttcc
gcgccgtacctgacagaaatggtgcgtcaggagatgatcagccgttatggcgaaaatgcc
tacgaggatggttataaggtttacaccaccattacccgccgcattcagcaggccgcgcag
aaagcggtgcgcgacaacgtgatggattacgacatgcgccacggttatcgcggcccgtct
aacgtgctgtggcgcgtgggcgaagtggcgtgggacagcaagaaaatcaccgattcgctg
aaaaacctgccgacctacgggccgctgctgcctgcggtagtcacctcggcgaatcctgac
gaagcgacggcgttgcttgctgataactcctcggtgtcgctgaagatggacggcgtgcgc
tgggcgcgcccttaccgctccgataccgcgcagggcccgacgccgcgccgcgtcaccgac
gtgttgcaggcaggccagcagatttgggtgcgtaaggtcgatgacagttggtggctcgcg
caggtgccggatgtcaactcggcgctggtttccatcaacccgaaagatggttcgatactg
gcgctggtgggcggctttgatttcaaccagagcaagttcaaccgagcgacccaggcgctg
cgccaggtcggctcgaacattaagccgttcctgtatacggcggcgatggacaagggcctg
acgctcgcgagcattctgaacgacgtgccgatttcgcgctgggatgccggtgcgggctct
gactggcgtccgaagaactctccgccggaatatgccgggccgattcgtctgcgccagggc
ctgggccagtccaagaacgtagtgatggttcgcgccatgcgcgcgatgggtgtcgattac
gcggcggagtatctccagcgtttcggcttcccggcgcagaatatcgtgcataccgaatcg
ctggcgctcggctccgcgtccttcacgccattgcaggtcgcgcgcggctatgcagtgatg
gcgaacggcggcttcctggtggacccgtggtttatcagcaaaatcaccaatgttcagggc
gaaacgctgtttgaagcgaagccgaaaatcgcctgcccggattgcgatatcccggtgatt
tacggcgaaacgccgaaatcaaacgtgctggaaaacaaagacgtggaaaacgtcgccacc
tctgccgaacagcagaacgcgccggtgccgatgccgcagcttgagcaggcgaaccgcgat
ctggtggcgcagagcccggcaccgcagtatgcgccgcacgtcatcagcacgccgctgtcg
tttttgattaaaagcgcgctgaacagcaatatcttcggcgagccgggctggcagggaaca
ggctggcgcgccggacgcgatctcaaacgtcgcgatatcggcggtaaaaccggtacgacc
aacagctcaaaagacgcctggttctccgggtatggtccgggcgtggtgacgtctgtgtgg
attggctttgacgatcaccgccgcgatctcggccgcaccacggcctcgggcgcgattaaa
gatcagatctccggctatgagggcggtgcgaaaagcgcgcagcctgcgtgggatgcgtat
atgaaggccgcgctggaaggcgtgccggaagagccgttaacgccgccgccgggcatcgtg
acggtcaatatcgaccgcagcaccggccagctggcgaacggcggcaacagccgtgaagag
tactttatcgaaggcacgcagccgacccagcaggcggtgcatgaagtcggcacgacgatt
atcgataacggggaaacccacgagctgttctga

DBGET integrated database retrieval system