KEGG   Cronobacter sakazakii ES15: ES15_0280Help
Entry
ES15_0280         CDS       T02119                                 

Gene name
aroK1
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
csk01130  Biosynthesis of antibiotics
csk01230  Biosynthesis of amino acids
Module
csk_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ES15_0280 (aroK1)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ES15_0280 (aroK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 dNK Cytidylate_kin AAA AAA_16 AAA_22 APS_kinase TsaE ABC_tran AAA_7 AAA_17 AAA_5 Ploopntkinase3 MMR_HSR1 RNA_helicase AAA_PrkA His_biosynth AAA_28 AAA_25 AAA_29 RsgA_GTPase PduV-EutP Mg_chelatase GTP_EFTU AAA_24 AAA_14 AAA_2 IstB_IS21
Motif
Other DBs
NCBI-ProteinID: AFJ97853
LinkDB All DBs
Position
315143..315664
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVDTPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLENN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgctggcaaaagcactatt
gggcgtcagttagcacaacagctcaacatggaattttacgactccgatcaggagatcgaa
aaacgtaccggagctgatgtcggctgggtcttcgatgtagaaggcgaagaaggtttccgc
gatcgcgaagaaaaagtcatcaatgaactgacggaaaagcagggtattgtactggcgacc
ggcggtggctctgtcaaatcccgcgaaacccgcaatcgtctctccgcgcgtggtgtggtg
gtctatctggaaaccactatcgaaaagcagcttgcccgtactcagcgtgataaaaaacgc
ccgctgttgcaggttgatacgccgccgcgtgaagtgctcgaggcgctcgccaacgaacgt
aatccgctgtatgaagagattgccgacgtcaccatccgtactgacgatcagagcgcaaaa
gtcgtggctaaccagattatccatatgctggaaaacaactaa

DBGET integrated database retrieval system