KEGG   Cronobacter sakazakii ES15: ES15_0936Help
Entry
ES15_0936         CDS       T02119                                 

Gene name
pheA
Definition
(GenBank) bifunctional chorismate mutase/prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
csk01130  Biosynthesis of antibiotics
csk01230  Biosynthesis of amino acids
Module
csk_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
csk_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ES15_0936 (pheA)
Enzymes [BR:csk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     ES15_0936 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     ES15_0936 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2
Motif
Other DBs
NCBI-ProteinID: AFJ98509
LinkDB All DBs
Position
complement(985990..987150)
Genome map
AA seq 386 aa AA seqDB search
MTAENPLLALRDKISALDEQLLALLAQRRALAVEVGKAKLATHRPVRDIDRERDLLERLI
SLGKTHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNQTNPHSARIAFLGPKGSYSHLAA
RQYAARHFDHFIESGCAKFHDIFNQVETGQADYAVVPIENTSSGAINDVYDLLQHTSLSI
VGELTLPIDHCVLVSTSTTLEKIETVYSHPQPFQQCSQFLKRYPNWKIEYCESTAAAMEK
VAHASSPYVAALGSEAGGALYGLQVLERNLANQTQNITRFVVLARKAINVSDQVPAKTTL
LIATGQQAGALVEALLVLRNHNLIMTKLESRPINGNPWEEMFYLDIQANLHDAAMQQALK
ELVEITRSMKVLGCYPSENVVPVDPA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactgcggaaaacccgttgctggccctgcgcgataaaatcagcgcgctggatgaacaa
ttactcgccctgctggcgcaacgccgggcgctggcggttgaggtaggcaaagcgaaactc
gccacccatcgtccggtcagggatatcgatcgcgagcgggatttactggagcggttaatt
agccttggcaaaactcaccatctcgacgcgcactacatcacccggctttttcagctgatc
atcgaagactccgttcttacccagcaggcgctactccagcagcatcttaaccagaccaat
ccgcactccgcccgcatcgcgtttctcggcccgaaaggctcttactcgcacctggccgcc
cgccagtatgcggcccgccatttcgatcacttcatcgaaagcggctgcgcaaaatttcac
gatatctttaatcaggtggagaccggccaggccgattacgccgtcgtgccgattgaaaac
accagctccggcgcgattaacgatgtctacgatctgctgcaacacaccagcctgtcgatt
gtcggcgagctgacgctgcctatcgatcactgcgtgctggtctccacctccaccacgctt
gagaaaatcgaaaccgtctacagccatccacagccgttccagcagtgcagccagttcctc
aagcgctacccgaactggaaaatcgaatattgcgaaagcaccgccgccgcgatggaaaaa
gtggcgcacgccagctctccgtatgtcgccgcgctcggcagcgaagcgggcggtgcgctc
tacggtttgcaggtgctggagcgcaatctcgccaaccagacgcaaaacatcacccgtttt
gtggtgctggcccgcaaggctatcaacgtatccgatcaggtgccggcgaaaaccacgctg
ttaatcgccaccggccagcaggctggcgcgctggttgaagcgttactggtgctgcgtaat
cacaatctgattatgacgaagcttgaatcgcgcccgattaacggcaacccctgggaagag
atgttctatctggatatccaggcgaatctccacgatgcggcgatgcagcaggcgctgaaa
gagcttgtggagatcacccggtcgatgaaagtgctgggctgttacccaagcgaaaacgtg
gtgccggtcgacccggcataa

DBGET integrated database retrieval system