KEGG   Cronobacter sakazakii ES15: ES15_1524Help
Entry
ES15_1524         CDS       T02119                                 

Gene name
fliY
Definition
(GenBank) cystine transporter subunit
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:csk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ES15_1524 (fliY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csk02000]
    ES15_1524 (fliY)
   02035 Bacterial motility proteins [BR:csk02035]
    ES15_1524 (fliY)
Transporters [BR:csk02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Cystine transporter
    ES15_1524 (fliY)
Bacterial motility proteins [BR:csk02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    ES15_1524 (fliY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 DUF4434
Motif
Other DBs
NCBI-ProteinID: AFJ99097
LinkDB All DBs
Position
1628828..1629628
Genome map
AA seq 266 aa AA seqDB search
MKLALLGRQALMGVMAVALVAGMSVKTYAAENLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAEALAKHLGVKASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDF
STPYTVSGIQALVKKENADSIKTAADLKGKKVGVGLGTNYEEWLRQNVQGVDIRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTSNTLAAAGEPFSRQEAGVAIRKGNDDFVKAVD
NAIAEMQKDGTLKKISEKWFGADVTK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgcacttttgggtcgtcaggcgctgatgggcgttatggcggtcgcgctggtc
gcgggcatgagcgtgaaaacctatgctgcggaaaatttgctgaataaagttaaagaacgc
ggcacgctgctggtggggcttgaaggcacttatccgccgtttagcttccagggcgatgac
ggtaagctgaccggctttgaagtggagttcgccgaggcgctcgcgaagcacctgggcgtg
aaagcctcgcttaaaccgaccaaatgggacgggatgctggcgtcgctggactctaagcgt
atcgacgtggtgattaaccaggtgaccatctccgatgagcgcaagaaaaaatatgatttc
tcaacgccgtataccgtttccggtattcaggcgctggtgaagaaagagaacgccgacagc
attaaaaccgcggccgatctcaagggtaaaaaagtgggcgttggtcttggcaccaactac
gaagagtggctgcgccagaacgtgcagggcgtggatatccgcacctatgacgacgacccg
accaaatatcaggatctgcgcgtaggccgtatcgacgccattctggtggaccgcctggcg
gcgctggatctggtgaagaagaccagcaatacgctggccgcggccggtgaaccgttctct
cgtcaggaagcgggcgtggctatccgcaaaggcaacgacgatttcgtcaaggccgttgat
aacgctatcgccgagatgcagaaagatggcacgctcaagaaaatctctgagaagtggttt
ggcgcggacgtgaccaaataa

DBGET integrated database retrieval system