KEGG   Cronobacter sakazakii ES15: ES15_2146Help
Entry
ES15_2146         CDS       T02119                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00480  Glutathione metabolism
csk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ES15_2146
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csk02000]
    ES15_2146
Enzymes [BR:csk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ES15_2146
Transporters [BR:csk02000]
 Other transporters
  Pores ion channels [TC:1]
   ES15_2146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AFJ99719
LinkDB All DBs
Position
2286839..2287447
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREANIDFTLVAVDLAAKRTETGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YHARVKARPAVAAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacatcattctgcgcgaa
gccaatatcgattttacgctggtggcggtggatctggccgcaaaacgcacggaaaccggc
gaagactatctgactatcaacccgaaaggtcaggtgccggcgctgctgctggatgacaat
acgctgctgacagaaggcgtggctattgtgcagtacatcgcagatcttgtcccggaccgt
cagttgctcgcgccggttggcagtatgacccgttaccatacgctggagtggctgaactat
atcgccaccgagctgcacaaaggctttacgcccctgttccgcccggatacgccggatgag
tacaagaccatcgcacgcgcgcagctgcagaagaaattcgcttacgtgaatgaggcgctg
gcgcagaaacagtggctgatggggctgcgcttcagcgtggcggatgcatatctgtttacc
gtgctgaactgggcgaaagcggtcggacttgagatgcaggcgtttgacaatatcgctgac
taccatgcccgcgtgaaagcgcgccctgccgtggcagccgcgctcaaagcggaaggcctg
agcgcgtaa

DBGET integrated database retrieval system