KEGG   Cronobacter sakazakii ES15: ES15_2158Help
Entry
ES15_2158         CDS       T02119                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
csk  Cronobacter sakazakii ES15
Brite
Enzymes [BR:csk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ES15_2158 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFJ99731
LinkDB All DBs
Position
complement(2296678..2297196)
Genome map
AA seq 172 aa AA seqDB search
MKRLTLAAMALLVCGAAQAASEEVELRLVTDKGVGQSVGMVKITETDKGLEFAPDLNGLP
PGDHGFHIHAKGSCEPAMKDGKMVAAEAAGGHFDPQNTGKHAGPEGDGHLGDLPVLAVNN
DGKATDPVTAPRIKKLDEVKGKALMVHVGGDNLSDHPKPLGGGGARYACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattaacactggcggcgatggcgctgctcgtatgcggtgccgcgcaggccgcc
agcgaagaagtggaactacgcctggtgactgacaaaggcgtaggtcagtccgtcgggatg
gtcaaaatcactgaaaccgataaaggtctggagttcgcgcccgatcttaacggccttccg
ccaggcgatcacgggtttcatattcatgccaaaggcagctgcgaacccgccatgaaagac
ggcaaaatggtcgcggcagaagccgctggcggccacttcgacccgcaaaataccggtaaa
cacgccgggccggaaggcgacggacatttaggtgacctgccggtgctggcggtgaacaac
gacggaaaagctaccgacccggtgaccgcaccgcgcatcaaaaagctggatgaagtgaag
ggcaaagcgctgatggtacatgtcggcggcgataacctgtccgatcatccgaaaccgctg
ggcggcggcggtgcccgttacgcctgcggcgttatttaa

DBGET integrated database retrieval system