KEGG   Cronobacter sakazakii ES15: ES15_2706Help
Entry
ES15_2706         CDS       T02119                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00020  Citrate cycle (TCA cycle)
csk00190  Oxidative phosphorylation
csk00650  Butanoate metabolism
csk01100  Metabolic pathways
csk01110  Biosynthesis of secondary metabolites
csk01120  Microbial metabolism in diverse environments
csk01130  Biosynthesis of antibiotics
csk01200  Carbon metabolism
Module
csk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csk_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ES15_2706 (sdhA)
   00650 Butanoate metabolism
    ES15_2706 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ES15_2706 (sdhA)
Enzymes [BR:csk01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ES15_2706 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ES15_2706 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: AFK00280
LinkDB All DBs
Position
complement(2905991..2907757)
Genome map
AA seq 588 aa AA seqDB search
MNLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMALRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGQLRDASDSDVEFSLERLNRWNNNRSGEDPVEIRKALQECMQHNFSVFREGDAM
AKGLEQLKAIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDYPDRDDENWLCHSLYLPQTESMTRREVNMQPKLRPAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgccagtcagagaatttgatgccgttgttattggcgcaggcggcgcaggtatg
cgcgcggcgctgcagatttcccagagcggccagacctgtgcgctgctctccaaggtgttc
ccgacccgttctcacaccgtctccgcccagggcggtattaccgttgcgcttggcaattcc
catgaagataactgggaatggcacatgtatgacacggtaaaaggttccgactatatcggc
gaccaggacgcgattgaatatatgtgtaaaaccggcccggaagcgattctggagcttgag
cacatggggctgccgttctcccgtcttgatgacggccgtatttatcagcgcccgttcggc
ggccagtcgaaaaacttcggcggcgagcaggccgcgcgcaccgcggcggcggcggaccgt
accggtcacgcgctgctgcatacgctctatcagcagaacctcaaaaaccacaccaccatt
ttctctgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtcgtgggttgc
accgcactgtgcatcgaaaccggcgaagtggtctacttcaaagcccgcgcgaccgtgctg
gcgaccggcggcgcaggccgcatttatcagtccaccaccaacgcccacattaacaccggc
gacggtgtcggcatggcgctgcgcgctggcgtgccggtgcaggacatggaaatgtggcag
ttccacccgaccggcatcgccggcgcgggcgtactcgtcaccgaagggtgccgcggcgaa
ggcggttacctgctgaacaaacatggcgagcgctttatggagcgttacgcgccgaacgcg
aaagatctggcgggtcgcgatgtcgtggcgcgctctatcatgatcgaaatccgcgaaggc
cgcggctgcgacggcccgtggggcccgcacgccaagctgaagctcgaccatctcggtaaa
gaagtcctggaatcccgcctgccgggcattctggaactctcgcgcacctttgctcacgtt
gacccggttaaagagccgatcccggtcatcccgacctgccactacatgatgggcggtatt
ccgaccaaagtgaccggccaggcgctgaccgtgaacgagaagggcgaagacgtggtgatc
ccgggcctgttcgccgttggcgaaatcgcctgcgtatcggtacacggcgccaaccgtctg
ggcggcaactcgctgcttgatctggtggtgtttggccgcgcggcgggcctgcatttgcag
gaatccatcgccgagcagggccagcttcgcgatgccagcgactccgatgtggagttctcg
ctggagcgcctcaaccgctggaacaacaaccgcagcggcgaagatccggtcgaaatccgc
aaagcgctgcaggaatgtatgcagcataacttctcggtattccgcgaaggcgacgcgatg
gccaaagggcttgagcagctgaaagctatccgcgagcgcctgaaaaacgcccgtctggac
gacacctccagcgagttcaacacccagcgcgtcgagtgcctggagctggacaacctgatg
gaaaccgcttacgccaccgccgtatcggcgaacttccgtaccgagagccgtggcgcgcac
agccgcttcgactacccggaccgcgacgacgaaaactggctgtgccacagcctctatttg
ccgcaaaccgagagcatgacgcgtcgcgaagtgaatatgcagcctaagctgcgcccggct
ttcccgccgaaagtgcgtacttattaa

DBGET integrated database retrieval system