KEGG   Cronobacter sakazakii ES15: ES15_2767Help
Entry
ES15_2767         CDS       T02119                                 

Gene name
dacA2
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase fraction A
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00550  Peptidoglycan biosynthesis
csk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ES15_2767 (dacA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csk01002]
    ES15_2767 (dacA2)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csk01011]
    ES15_2767 (dacA2)
Enzymes [BR:csk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ES15_2767 (dacA2)
Peptidases [BR:csk01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ES15_2767 (dacA2)
Peptidoglycan biosynthesis and degradation proteins [BR:csk01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ES15_2767 (dacA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AFK00341
LinkDB All DBs
Position
2977297..2978583
Genome map
AA seq 428 aa AA seqDB search
MPAHKAFAIVRHFFSLITDVVVQTMKTTFSVRFMQRLAVTTALSVAALSTAAHADDLNIK
TMIPGVPQIDAEAYILIDYNSGKVLAEQNADARRDPASLTKMMTSYVIGQAMKAGKFKES
DLVTIGNDAWATGNPVFKGSSLMFLKPGMQVPVSQLIRGINLQSGNDACVAMADYVAGSQ
DAFVGLMNSYVTALGLKNTHFQTVHGLDADGQYSSARDMALIGQALIRDVPNEYSIYKEK
EFTFNGIRQTNRNGLLWDNSLNVDGIKTGHTDKAGYNLVASATEGQMRLISAVMGGRTFK
GREAESKKLLTWGFRFFETVNPLKAGKEFASEPAWFGDNDRASLGVDKDIYLTIPRGRMK
DLKASYVLNTSELHAPLAKNQVVGTINFQLDGKTIEQRPLVVLEEIQEGNFFGRIIDYIK
LMFHHWFG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgccagcccataaggcatttgctatagtaaggcactttttttcactcatcacggatgtc
gttgttcagaccatgaagaccactttctccgttcgttttatgcagcgtctcgccgttacc
acggcgctttctgtcgcagccctttccaccgccgcccatgccgacgacctcaatatcaaa
acgatgatcccaggcgtgccgcagatcgacgcggaagcttacatcctcatcgattacaac
tcagggaaagtgctggcggagcagaacgctgacgcgcgccgcgatccggcgagcctgacc
aaaatgatgaccagctacgtcatcggtcaggcgatgaaagcaggtaaatttaaagagtcc
gatctggtgactatcggcaatgacgcctgggccaccggcaacccggtctttaaaggctca
tccctgatgttcctgaagccaggcatgcaggtgccggtctcgcagctgatccgcggcatt
aacctgcagtccggcaacgacgcctgcgtggcgatggccgactatgtggcgggcagccag
gacgcgtttgtgggcctgatgaacagctacgtcaccgcgcttggcctgaaaaacacccat
ttccagaccgtacatggtcttgatgcggatgggcagtacagctccgcgcgcgacatggcg
ctgattggccaggcgctgatccgtgacgtgccgaacgaatactctatctataaagagaaa
gaattcacctttaacggcatccgccagaccaaccgtaacggcctgctgtgggataacagc
ctgaacgtggacggcatcaaaaccggccacaccgacaaagcaggctataacctggtcgcg
tccgccaccgaaggccagatgcgccttatctccgccgtgatgggcggtcgcacgttcaaa
ggccgcgaagccgaaagtaaaaaactgctcacctggggcttccgcttcttcgaaactgtg
aacccactgaaagccgggaaagagtttgcgtctgagccggcgtggtttggcgataacgac
cgcgcctcgttgggtgtggataaagatatctatctgaccatcccgcgcggtcgcatgaaa
gatctgaaagcgagctacgtgctgaatacttccgagctgcacgcgccgctcgcgaaaaac
caggtggtcggcaccattaacttccagctggacgggaaaaccattgagcagcgcccgctg
gtcgtgctggaagagattcaggaaggcaatttctttggtcgcatcatcgattacatcaag
ctgatgttccaccactggtttggttaa

DBGET integrated database retrieval system