KEGG   Cronobacter sakazakii ES15: ES15_3230Help
Entry
ES15_3230         CDS       T02119                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk00473  D-Alanine metabolism
csk00550  Peptidoglycan biosynthesis
csk01100  Metabolic pathways
csk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ES15_3230
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ES15_3230
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ES15_3230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csk01011]
    ES15_3230
Enzymes [BR:csk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ES15_3230
Peptidoglycan biosynthesis and degradation proteins [BR:csk01011]
 Precursor biosynthesis
  Amino acid ligase
   ES15_3230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp ATPgrasp_Ter TTL Csa1
Motif
Other DBs
NCBI-ProteinID: AFK00804
LinkDB All DBs
Position
complement(3489995..3490915)
Genome map
AA seq 306 aa AA seqDB search
MAEKIAVLLGGHSAERDVSLQSGSAVLAGLKEAGVDAYAVDPRDVCVTTLKEEGFDKVFI
ALHGRGGEDGTLQGMLEYLGLPYTGSGVMASAITMDKLRTKLLWQGAGLPVAQWVALERQ
DITGGLSEALSARIAALGLPVIVKPSREGSSVGMSKVDSAEALLPALELAFEHDSEVLVE
KWLSGPEFTVAILGDEILPSIRIQPAGVFYDYEAKYLSDETQYFCPAGIDAEREQALQAL
VMDAWRVLGCRGWGRVDVMQDSDGEFYLLEVNTAPGMTSHSLVPMAARQAGMTFSQLVVR
ILELAN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaaatcgctgtactgctgggcggtcactcggcggaacgtgacgtctccctg
caatccggcagcgcggtactcgcgggtctgaaagaggcgggcgtggacgcatacgctgtc
gatccgcgcgacgtatgtgtgacgacgctgaaagaagaagggttcgataaagtctttatc
gcgctgcatggtcgcggcggcgaagacggcacgctgcagggaatgctggagtatctcggc
ctgccttataccggcagcggtgtgatggcgtcggccatcaccatggataaattgcgcacc
aaactgctctggcagggcgcgggtttaccggtagcgcagtgggtggcgctggagcgtcag
gacatcaccggcggccttagcgaggcattaagcgcgcgtatcgcggcgctgggcctgccg
gttatcgtgaagccgagccgcgaaggttcaagcgtcggcatgtcgaaagtggacagcgcg
gaagcgttactgcccgcgctcgaactggcgtttgaacacgacagcgaagtgctggtggag
aaatggctgagcggcccggaatttacggtcgccatccttggcgatgaaattctgccttcg
atccgcattcagcctgctggcgtgttttacgactacgaggcgaagtatctctcggacgag
acgcaatatttttgtccggcgggcattgatgccgaacgcgagcaggcgttacaggcgctg
gtgatggacgcctggcgtgtgctgggctgccggggctggggacgcgtggacgtgatgcag
gacagcgacggtgagttttatctgcttgaggtaaacaccgcgcctggcatgaccagccat
agtctggtgccgatggcggcgcgtcaggcgggcatgaccttctcgcaactggtggtgcgt
attctggagctggcgaactga

DBGET integrated database retrieval system