KEGG   Cronobacter sakazakii ES15: ES15_3425
Entry
ES15_3425         CDS       T02119                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
csk  Cronobacter sakazakii ES15
Pathway
csk03030  DNA replication
csk03430  Mismatch repair
csk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:csk00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ES15_3425
   03430 Mismatch repair
    ES15_3425
   03440 Homologous recombination
    ES15_3425
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csk03032]
    ES15_3425
   03400 DNA repair and recombination proteins [BR:csk03400]
    ES15_3425
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ES15_3425
DNA replication proteins [BR:csk03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ES15_3425
DNA repair and recombination proteins [BR:csk03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     ES15_3425
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AFK00999
LinkDB
Position
3716030..3716491
AA seq 153 aa
MKNATFYLLDNDDTADGLSAVEQLVCDVAAARWRAGKRILIACVDEAQATRIDEALWKRD
PDSFVPHNLAGEGPRGGAPVEIAWPQKRGSSPRELLISLLPEFAAFATAFYEVVDFVPYD
ESQKQLARERYKAYRAAGFHLTTATFTAPGTTQ
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaagaacgcaacgttttacctgctggacaacgacgacaccgccgatggcctgagcgcc
gtggaacaactggtgtgcgacgttgccgctgcgcgctggcgcgcagggaaacgcatcctg
attgcctgcgtcgacgaagcccaggccacccgcattgacgaagcgctctggaagcgcgac
ccggacagcttcgtgccgcacaatcttgcgggcgaagggccgcgcggcggcgcgccggtg
gaaatagcctggccgcaaaaacgcggcagcagcccgcgggagcttctgataagcctgctg
ccggaattcgcagcttttgccactgctttctatgaagtggtagacttcgtaccttacgac
gaatcccagaaacaactggcgcgcgaacgctacaaagcctatcgcgccgctggtttccac
ttgaccacggccaccttcacggcgcccggaacgacacagtag

DBGET integrated database retrieval system