KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_1093Help
Entry
COCSUDRAFT_1093   CDS       T02914                                 

Definition
(RefSeq) hypothetical protein
Organism
csl  Coccomyxa subellipsoidea
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 Cellulase
Motif
Other DBs
NCBI-GeneID: 17040108
NCBI-ProteinID: XP_005646666
JGI: 1093
UniProt: I0YUQ3
LinkDB All DBs
AA seq 632 aa AA seqDB search
ILLLSLAVAMSNALEERLFSIENDQFKMDGKPFRIISGSLHYHRIHPAQWKDRMLRTKAL
GLNTLSVYVPWNLHEPFPGQYNWDGFADLEAYLALAQEQGLYVLLRPGPYICAEWDFGGF
PWWLASSKAGLCSTSSHSVTLRSDDPAYLELVDRWWKVLLPKIGRFLYSRGGNILMVQVE
NEFGFVGPNEKYMRHLVGTVRASLGDDALIYTTDPPPNIAKGTLPGDEVLSVVDFGAGWF
DLNWAFSQQRAMNAPGKSPPMCSEFYTGWLTRWGEKMANTSVDQFLDTLHGVLGFANNTG
SVNLYMVHGGTNFGFTAGGSIDNGVYWACITSYDYDAPISEAGDTGQPGIGGPNKFDLIR
EAITQHTGAEPPKPPPPPRIKAYGEVGLYENVTLRSQIRRLYPGDGVTSRRPLIMEEYGQ
SGGLIMYQTEIPAAEMKANSLLDMGHPVHDAATVTVGRLSRNGPVNLTLDADSALRWRSV
EEAAGSYAVASAEASVTLEVIVEAVGRSNQGWRFDTKGLSSSDVQWNGKVLEGWRVFPLP
LDNLGRLVFHDNDSATAHSLAPADGGPAFFRDEEGLLPDSYLFVGDWGKGLAFVNGFNLG
WYWPSKGPANTMYVPGPVLRAGVNEVIMLEVE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
attctgctgttgtcccttgctgttgcgatgagcaatgcactggaagaaagactcttttct
atcgaaaacgatcagtttaaaatggatggcaagcccttcaggatcatatccggcagccta
cactaccacaggatacatccggcgcaatggaaggacaggatgctgcgaacaaaggccctg
ggcctcaataccctgtcggtgtacgtgccctggaacctgcacgagcccttcccaggacag
tacaattgggatggctttgctgacctggaggcttacctggcgctcgctcaggagcagggc
ttgtatgtgctgctgcgcccggggccttacatctgcgctgagtgggactttggaggattt
ccctggtggctcgcctcctccaaggcaggcctctgctcgacatcttcacacagcgtcacc
ctgcgctcggacgatccggcgtatctggagttggtggatcggtggtggaaagtgctgctg
cccaagatcgggcgctttctgtacagccgtggagggaacattctcatggtgcaggtggag
aacgagttcggctttgtgggtcccaatgagaagtacatgaggcatctggtgggcacggtg
cgcgcatctctgggggatgacgcgctcatttacacaacggacccgcccccaaacatcgcc
aaggggacgctgcccggggacgaggtgctcagtgtggtggattttggcgccggctggttc
gatctgaactgggctttctcacagcaacgagccatgaatgcccctgggaagtcaccgccc
atgtgcagcgagttctacacgggttggctgacgcggtggggcgagaaaatggcaaacaca
tccgtggaccagtttctggacacgctgcatggagtgctgggtttcgcaaacaacaccggc
tctgtgaatctatacatggtccatggcggcaccaactttggcttcactgcaggcggtagc
atcgacaatggcgtctattgggcatgcattacgtcatatgactacgatgcgccaatcagc
gaggcaggcgacaccggccagcccggcatcgggggacccaacaaatttgacctcatccgt
gaggcaataacacagcacaccggtgcggagccgccaaagccgccgccaccgccacgcata
aaagcctatggagaagttggactgtatgagaatgtgacactgcggagccagatcaggcga
ctgtacccgggcgacggcgtgacctcccgccgcccactcatcatggaggaatacggccaa
tcgggtggcctgataatgtaccagacagagattcctgcagccgagatgaaggccaactcg
ctgctggacatggggcatccggtgcatgatgcagccacggtgacagtcggccggctgagc
cgcaacggccccgttaatctgacgctggacgccgactcagcgctgaggtggcgctcagtg
gaggaagctgccggaagctatgcggtggcttccgcggaagcttccgtgacgctggaagtc
attgtggaagctgtggggcgctccaaccaggggtggcgcttcgacaccaaggggctgtcg
tcctcagatgtacagtggaacggcaaggtgctggaggggtggagggtgttccctctccct
ctggacaacctgggcagattggtcttccatgataatgacagcgctaccgcgcactcttta
gcaccagcagatggaggacctgccttcttcagggatgaagaggggctgttgccagacagc
tatctgtttgtgggcgactggggcaagggactggcctttgtgaatggcttcaacctgggc
tggtactggccgtcaaaggggcccgccaacaccatgtacgtgccaggccctgtgctgcgg
gcaggagtgaatgaagttatcatgctggaagtggaa

DBGET integrated database retrieval system