KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_15651Help
Entry
COCSUDRAFT_15651  CDS       T02914                                 

Definition
(RefSeq) TK-domain-containing protein
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00240  Pyrimidine metabolism
csl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    COCSUDRAFT_15651
Enzymes [BR:csl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     COCSUDRAFT_15651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-GeneID: 17041072
NCBI-ProteinID: XP_005647628
JGI: 15651
UniProt: I0YXG5
LinkDB All DBs
AA seq 245 aa AA seqDB search
MAVVGPTRSYLSGASSGLIADDGQIQLILGPMFAGKTSELIRRTRRFGQYKKCLLVAYKG
DNRCGSDASVVTHDQTGMKAKSVEKLSQVENAAHCYNVIGVDEGQFFPDVVEYAERWANE
GKIVIIAALDGTFQRQPFNSILELIPLAEEVLKLRAVCSGCHREAAFTHRLGNEQEVEVV
GGAENYVASCRACYHSYNDSRSGAPAAPEPKGTPTSAQRFPSVFLLLNHTSHWLLSILIL
PGPAS
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgtggggcccacgcgttcctatctgtccggcgcaagctcgggcttaattgca
gacgatggacaaatccagctcattctgggtcccatgtttgccggtaaaacgtcagagctg
atacgacggaccaggagatttgggcaatacaaaaaatgcctcttggttgcatacaagggc
gacaatcgctgcggttctgacgccagtgtggtcacgcatgatcaaactggaatgaaggca
aagtctgtcgaaaagttgagccaggtcgagaatgcagcacactgttacaacgtcattggc
gttgacgaagggcaattcttcccagacgttgtggagtatgcggaacggtgggccaatgag
ggaaagatcgtcatcatcgcagccctggatggcacgttccaaagacagcccttcaatagc
atactcgagctaattcccctggctgaagaggtgttgaagctccgagcggtgtgcagcggc
tgccatcgcgaggcagccttcacccacaggcttggcaatgagcaggaagttgaggttgtg
ggcggtgctgagaactatgtggcttcgtgccgcgcctgctaccactcctacaatgactcg
aggagtggtgcaccggccgctccagagcccaagggaactcccacttcagctcagaggttt
ccctctgtcttccttcttctgaatcatacgagtcattggcttctaagcatcctgatcttg
ccaggacctgcatcctag

DBGET integrated database retrieval system