KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_16393Help
Entry
COCSUDRAFT_16393  CDS       T02914                                 

Definition
(RefSeq) ATP-dependent DNA ligase
Organism
csl  Coccomyxa subellipsoidea
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme RNA_ligase
Motif
Other DBs
NCBI-GeneID: 17040759
NCBI-ProteinID: XP_005647316
JGI: 16393
UniProt: I0YWK3
LinkDB All DBs
AA seq 643 aa AA seqDB search
GAAEVAAAGSAVKREAEEAVTWPEGTPAPYLVIARAFAAMESTTKRLAKDNIMAEMFRGI
LRCSPGDVVAAAYLTMGKIAPEHEGTELNVGGSIISTAIREATGVSRQKLHALYNELGDP
GDVAEACRHTQTMLIQPAPLTVRGVFKSLHSMAQQKGAGATARRRQTILHLLRSCRDCET
RYLVRTLVQNLRVGANWRSVIGSLARAVLLESEANRPAKARLDAAATAAVEAFHVCPSLD
ILVAAMLEPGGVENLDTRISLTPGVPLKPMLASITEGVADAIQQLQGQHFLAEYKYDGIR
AQIHLHKNGDVRIFSRNCEERTSSFPDVADAVRSAAAGGCKEVVLDAELVAVDREKANEL
KSFQELSTRARGAITSLEVKVPVCVFAFDCLYVDGESLLKQPLQERRKRLAAALPSLRPG
FVCLAQSHAGTEALIREHLQDALAAGTEGLMLKALTGPSATYQPSKRSNSWLKIKRDYCE
ELRDSLDLVPIGAWHGNGRKVGWYSPFLLAAWDPDAEEFQTVCRCMSGFSDAFYAQARPG
MMHPHAMLISFHRIEGPRPYYSTNERPSVWFEPTEVWELRGADLTLSAVHKAAFGLIHPT
RGVSLRFPRFVRLRDDKRPEEASTPEVIRCHILPHRLIIVFML
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
ggcgcggcggaggtggcggcggccggcagcgcggtgaaacgggaggcggaggaagctgtg
acgtggccggagggcacgcctgcgccctacctggtcatcgcgcgcgccttcgcggccatg
gagtccaccaccaagcggctcgccaaggacaacatcatggctgagatgttccgcggcatc
ctgcgctgctcgccaggtgacgtggtggcagcggcatacctgacgatgggcaagatagcg
ccggagcatgagggaacagagctgaacgtgggcggcagcatcatctcgacagccatccgc
gaggccacaggcgtctccaggcagaagcttcatgcgctgtacaatgagctcggcgaccct
ggggacgtagctgaggcctgtcgccacacccagacaatgctgatacagccggctccgctc
acggtgagaggcgtattcaagagcctgcatagcatggcgcagcagaagggcgctggcgcc
acagcccggcgcaggcagaccatcctgcacctgctccgcagctgcagggactgcgagacg
cggtacctggtgcgcacgctggtgcagaacctgcgggtgggcgccaactggcgctccgtc
attggctcgctcgcgcgcgcagtgctattggagagcgaggccaaccggccggccaaggcg
cgcctggacgcggccgccacggcagctgtggaggcgttccatgtctgccccagcctcgac
atcctggtggcagccatgctggagcctggcggcgtggagaaccttgatacgcgcatctcc
ctcacccccggtgtcccactgaagcccatgctggcttccatcacggagggagtggctgac
gccatccagcagctgcaggggcagcactttctggccgaatacaagtatgacggcatcagg
gcgcagatacatttgcacaagaatggggatgtgcggatcttctccagaaactgcgaggag
cggaccagcagcttccctgatgtggcggacgctgtgcgcagtgctgctgctggtgggtgc
aaggaggtggtcctggatgcagagctggtggctgtggaccgagagaaagccaatgagcta
aagagcttccaagaactctcaaccagggcgcgaggggccatcacatctctcgaggtcaag
gtgccagtctgcgtgtttgccttcgactgcctctacgtggacggcgagtcgctgctgaag
cagccgctgcaggaacgccgcaagcgcctggccgccgcgttgcccagcctgcgccccggc
ttcgtctgcctcgcgcagtcgcatgccggcacggaggcgctgatccgggagcacttgcag
gacgcgctggccgccggcacggaggggctcatgctcaaggcgctgaccggcccttcggcc
acttaccagccctccaaacgcagcaactcctggctcaagatcaagcgggactactgcgaa
gagttgagggattcgttggatctggtgccgatcggggcgtggcacggcaatggacgcaag
gtgggctggtactcgcccttcctgctggcagcctgggaccccgatgccgaagagttccag
actgtctgccgctgcatgtccggcttctccgacgccttctacgcccaggcgcggcccggg
atgatgcaccctcatgcaatgctcatctcttttcaccgcatagagggcccaaggccttac
tacagcaccaacgagcgccccagcgtctggtttgagccgacagaggtgtgggagctgcgc
ggagcagacctcactctctcagccgtgcacaaggccgccttcgggctcattcaccccact
cgcggcgtatctctcaggtttccacgctttgtgcggttgagagatgacaagcgtcccgag
gaggccagcaccccagaagtcatcaggtgccatattttaccgcaccgcctcattattgtg
tttatgctgtga

DBGET integrated database retrieval system