KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_23592Help
Entry
COCSUDRAFT_23592  CDS       T02914                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCSUDRAFT_23592
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csl02000]
    COCSUDRAFT_23592
Enzymes [BR:csl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COCSUDRAFT_23592
Transporters [BR:csl02000]
 Other Transporters
  Pores ion channels [TC:1]
   COCSUDRAFT_23592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C_2 GST_N_4 GST_N GST_C_5 GST_C_3 GST_C TniQ Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 17041645
NCBI-ProteinID: XP_005648197
JGI: 23592
UniProt: I0YZ34
LinkDB All DBs
AA seq 528 aa AA seqDB search
MSCHLRWVLPSTVCPPLLLSRRSNLTQPLHERSSLRHSDRHSTLITRASIPSVPSMLGSL
QSLLNQPGAKAGKQTTTFSDNAPSWEALQQLVEEKGRQLNWQQPDLENGPTNPLALKRTF
GQPGTPRVKLYRDHAAWCPYCQKVWLQLEEKQIPYTLEKINMRCYGDKPPEYTAKVPSGL
LPAMELDGQLIVESAEIMRILEEAFPDNKPLLPPKGSKERQRADSLMRLERRLFSDWLSW
LTTSWQAPSSHTIPLPHCMLALRTTREFIATMDAVDRELGAAGGPFFLGADLSMVDVVFS
PFLERIAASILYYKGLTVRGDGRWKNLERWFESMEARPAYIGTRSDFYTHVHDLPPQLGG
CASVPDADEAAAAIDGVDGKSWQLPLPPLNATSFPEPYSPGEDPPLDRLRAAARLVGNHG
AIAKFAARGCGKPGRRPVSAPLSDPTATAGENFLEAVDAGLRHVAHALLEGAHASSLRVG
DGENLPGDAVVASAEYIRDRVGVPRDLPYPAARQLRAHLNWLIGSLTA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgccatttgcgttgggtgttaccatccacagtttgtcctcctcttctgctgtca
agaagatcgaacctcacccaaccattgcatgagaggagctcgttgagacactccgacaga
cacagcaccttgataactcgtgccagcatcccatcagttccttccatgttgggaagcctg
cagagtcttctaaaccagcctggcgcaaaggctggcaagcagacaaccacgttctcagat
aacgctccatcctgggaggccttgcagcagctggtggaggagaagggcaggcagctcaac
tggcaacagcctgacttggagaatggacccacaaacccactggcactgaagaggacattt
gggcagcctggtacccctcgagtgaagctgtacagggaccatgccgcttggtgcccctac
tgccagaaggtgtggctgcagctggaagagaagcagatcccttacaccctggagaagatc
aacatgcgctgctacggagacaaaccgccagagtacacagccaaggtgccttcagggctg
ctgccggcgatggagctggatgggcagctgatcgtggagagcgctgagatcatgcgcatc
ctggaggaggctttccctgacaacaagcccctgctgccgcccaagggcagcaaggagcgc
cagcgtgccgactctctcatgcgcctggagcgccgcctcttctcagactggctctcctgg
ctcaccacctcctggcaagctccttcctcccacaccatccctctgccccactgcatgctt
gctctgcgcactacacgcgagttcatagccacgatggatgcagtggacagggaacttggg
gctgcgggggggcccttcttcctcggggcggatctgtcaatggtggacgttgtgttttcg
cccttcctggagcgcattgctgcctccatcctgtactacaaggggctcactgtgcgcggg
gacgggcggtggaagaatttggagaggtggtttgagtcgatggaggctcgacctgcatac
attggcaccaggagtgacttctacacgcatgtgcatgacctgccacctcagcttggaggg
tgcgcatcggtgcctgacgcggatgaggcggcggctgccatcgacggagtggatggcaag
agctggcagcttcccctgcctcccctcaacgccacctcgttcccagaaccttactcccca
ggtgaggatccgccactggaccggctcagggcagcggcgcggctggtgggcaaccacggc
gccattgcgaagttcgctgcgcgcggctgcggcaagccaggacggcggcctgtgagcgcc
ccgctgtccgatcccactgccactgctggggaaaacttccttgaggccgtggatgcaggc
ctgcggcatgtggcgcatgctctgctggagggagcacatgcgagcagcctgcgagtgggt
gatggggagaatctaccgggggatgcagtggtggcatcagcagagtatattagagacaga
gtgggtgtaccccgcgacctgccctatccagctgccaggcagctgcgcgcgcacctgaac
tggctcatcggctccctcacggcctga

DBGET integrated database retrieval system