KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_24901Help
Entry
COCSUDRAFT_24901  CDS       T02914                                 

Definition
(RefSeq) actin-like ATPase domain-containing protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00010  Glycolysis / Gluconeogenesis
csl00051  Fructose and mannose metabolism
csl00052  Galactose metabolism
csl00500  Starch and sucrose metabolism
csl00520  Amino sugar and nucleotide sugar metabolism
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
csl01200  Carbon metabolism
Module
csl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCSUDRAFT_24901
   00051 Fructose and mannose metabolism
    COCSUDRAFT_24901
   00052 Galactose metabolism
    COCSUDRAFT_24901
   00500 Starch and sucrose metabolism
    COCSUDRAFT_24901
   00520 Amino sugar and nucleotide sugar metabolism
    COCSUDRAFT_24901
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    COCSUDRAFT_24901
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csl04131]
    COCSUDRAFT_24901
Enzymes [BR:csl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     COCSUDRAFT_24901
Membrane trafficking [BR:csl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    COCSUDRAFT_24901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 17039277
NCBI-ProteinID: XP_005645638
JGI: 24901
UniProt: I0YRS5
LinkDB All DBs
AA seq 559 aa AA seqDB search
MWSAVGRLPLPSFPQTQIGSIRCRSSWCLAHGSCSSRHKINYIQQRPRGHIIVRCFSQRL
SVMDVERRDAEIKKYWDRLHLSPEALKQLANAFQDELEAGLEQKSSLLMIPTMVDMLPQG
HECGDYYAIDLGGTNLRVLYTRLGKGPKEVEAEAINSAPIPPEMQSCPVEELMDYVAGHL
IDWSEQHHCSIREREVPIIGFCFSFPVEQTAVDAGTLLRWTKGYTNPGAVGKDPAKLLHE
AFKRRGVNVHIGALLNDTVGTLAAARYVDGQDTIAAMIMGTGTNACYMELLGRITKWLPH
YRPRTSDMVVNIEWPGFQAAELPILEEDRHLDEESNNPGQQRFEKLTAGLYMGDIARRII
LRAAEERELFDGRVPEGLRTMETFPTKFVGIAAQDDTPDLSRTAGVLHRAFGFDPDSISP
QDRKEVKEICAMVTVRSARLVAAAVCGIMRHLGRDVGDPAGGAPPRTCIAVDGGIFVRYG
FYRELLKQGVRDILGDAVADQFELRVVAGGSAFGAACVAAASHSYMRGVGQDEGRPSPPP
RRFPPRRPSAVSLQDLAGQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcagctgttggacgcttgccattgcctagctttcctcaaacgcagataggaagc
atcagatgtagatccagctggtgtttggcccacggatcttgttcttctcgccacaaaatt
aattatattcagcagagaccacgtgggcacatcatcgtgaggtgtttcagccagcgactt
tctgtgatggacgtggaacgcagagatgctgaaataaaaaagtattgggatcggctacac
ctgtcgccggaggctctgaaacaattggcaaatgccttccaagatgagctcgaagctggc
ctggagcagaagagctccctgttgatgatacccaccatggtggacatgcttccacaaggg
catgagtgtggcgattattatgcaatcgatctgggaggcacaaacctgagagtgctttac
acccgtttggggaagggtcctaaggaagtggaggcagaggcgattaactcagcgcccatc
ccaccagagatgcagagttgccctgtggaagagctcatggactatgtggcaggccacctc
atcgactggtcagagcagcaccattgtagcataagggagagagaagtgcccatcatcggc
ttctgcttcagcttcccggtagagcagacagccgtagatgcagggacgctgctgaggtgg
accaagggctacaccaatcctggagctgttggcaaagaccctgccaaactgctacatgag
gcattcaagcgcagaggggtcaatgtacacataggagcgctgctgaatgacacagtgggc
acactggctgcggcaagatatgtcgatgggcaggacacaattgctgctatgattatgggc
acaggcacaaacgcatgctacatggagcttttggggcgcatcacaaagtggctgccgcac
taccggcctcgcacctcagacatggttgtcaacattgagtggcctggattccaggcagcg
gagttgccgatactggaagaggaccggcacttggatgaggagtccaacaacccaggccag
cagcgctttgagaagctgactgccggcctctacatgggggacattgcgcgccgcatcatc
ctcagggcggcagaggagagggagttgtttgatgggcgggtgccagaggggctgcgcacg
atggagaccttcccaacaaagtttgttggcatcgccgcacaggatgacaccccagacctg
agcaggacagccggcgtcctgcatcgagcttttggcttcgacccggacagcatcagcccc
caggatcgcaaggaggtgaaggagatatgcgcgatggtgacggtgcgcagcgcgcggctg
gtggcggcggctgtgtgcggcatcatgcgccacctgggccgggacgtgggggaccccgcg
gggggggcgcccccccgcacctgcattgcggtggacggggggatcttcgtgcgctacggc
ttctaccgcgagctcctgaagcagggcgtgcgcgacatccttggggacgctgttgcagac
cagtttgagctgcgggtggtggcgggcgggtcggcgtttggggcggcctgtgtggcagcg
gcgtcgcacagctacatgcgcggcgtggggcaggacgaagggcggccgtcaccgcctccg
cgcagatttccgcctcgccgcccctcggccgtctcgctgcaggacttggccgggcagtag

DBGET integrated database retrieval system