KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_26120Help
Entry
COCSUDRAFT_26120  CDS       T02914                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl03030  DNA replication
csl03410  Base excision repair
csl03420  Nucleotide excision repair
csl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    COCSUDRAFT_26120
   03410 Base excision repair
    COCSUDRAFT_26120
   03420 Nucleotide excision repair
    COCSUDRAFT_26120
   03430 Mismatch repair
    COCSUDRAFT_26120
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csl03032]
    COCSUDRAFT_26120
   03400 DNA repair and recombination proteins [BR:csl03400]
    COCSUDRAFT_26120
Enzymes [BR:csl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     COCSUDRAFT_26120
    6.5.1.6  DNA ligase (ATP or NAD+)
     COCSUDRAFT_26120
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     COCSUDRAFT_26120
DNA replication proteins [BR:csl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    COCSUDRAFT_26120
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     COCSUDRAFT_26120
DNA repair and recombination proteins [BR:csl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     COCSUDRAFT_26120
   NER (nucleotide excision repair)
    Other NER factors
     COCSUDRAFT_26120
   MMR (mismatch excision repair)
    Other MMR factors
     COCSUDRAFT_26120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2 eIF-3c_N
Motif
Other DBs
NCBI-GeneID: 17036874
NCBI-ProteinID: XP_005643468
JGI: 26120
UniProt: I0YKK5
LinkDB All DBs
AA seq 651 aa AA seqDB search
MEGVGLGAVAAAKAYANFDSAELATWKAGEPVPFLFLASTFEAIANQPKRLQMTQLLVTA
FRTILATTPEDLLPAVYLCSNQVAPSHEGLELGIGDSILMKALCQATGKSMQKIKDDYAE
AGDLGNVAAAARAKQKTMFKPKPLTVQGVFKAFQAIARTQGTKSQERKVDLINKLLVSST
DVEPGFIMRALQGKLRIGLGDETVRVALAHAQSLHRHGADNADGKLANRLETAVQAVKQA
YSQCPSYDALIPALLQYPIEDLPDHVRFTPGVPVKPMLAKATTGIAEVLEKFTDQEFTCE
YKYDGERAQVHYTEDGKVFIYSRNSENNTGKYPDIAAIVPSMVREGVKSMVLDCEAVAFE
RATGKILPFQVLSTRKRKDVEVADIKVQVCLFAFDCLYLNGAMLLQKPLTERRTALSQAV
REKPGELQFALFKAHSYTSTDVEELGTFLNESVAAGTEGLIVKTMDSTYEPSRRSLHWLK
LKKDYLEGVGDTLDVAVIGAWFGKGKRSGVFGAFLLAVYNPEGEEFQTISKIGTGFSEEQ
LKQFSEELRLHTIPTAKPYYRYSETLLPDIWFDAKTVWEVKCADFSISPRHKAALGLADP
DKGISIRFPRLVKVRDDKTPEDATSAEQVAEMYFKQALTSGQQKGKQEDEE
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggagggtgtggggctcggggcagtggcggcagccaaggcatacgccaactttgactct
gctgagctggccacatggaaggcaggggagccggtgcccttcttgttcctggcatccacc
tttgaggccatcgcaaaccagcccaagcggctgcagatgacccagctgctggtcacagcc
ttcagaaccatcctggctaccaccccagaagacctcctgcccgctgtctacctctgcagc
aaccaggtggctccatcccatgagggtctggagctgggcattggggactccatcctgatg
aaggcgctctgtcaggccaccggcaagtcaatgcagaagatcaaggatgactacgcggag
gcgggggacctgggcaacgtggcggcggctgctcgagccaagcagaagaccatgttcaag
cccaagcccctcaccgtgcagggcgtcttcaaggcgttccaggccatagcgaggacgcag
ggcacaaagagccaggagcgcaaggtcgacctcatcaacaagctgctcgtgtcttccacc
gatgtcgagccgggcttcatcatgcgcgccctgcaggggaagttgaggataggcctgggg
gacgagacagtgcgggtggcgctggcgcacgcgcagtcgctgcaccgtcacggcgctgac
aatgctgacggcaagctagccaaccgcctggagacggccgtgcaggccgtcaagcaggcc
tacagccagtgcccctcctacgacgccctcatccccgccctcctccagtaccccatcgag
gacttgccggaccatgtgagattcacaccgggggtgccggtgaagccgatgctggccaaa
gcgaccacaggcatcgcagaggttctggagaaatttacggaccaggagttcacttgcgag
tacaagtatgacggggagcgcgcccaggtgcactacactgaggacggcaaggtcttcatc
tacagccgaaacagcgagaacaacacgggcaagtacccggacatagcggccatcgtaccc
agcatggtgcgcgagggcgtcaagtccatggtcctcgactgcgaggccgtcgccttcgag
cgcgccaccggcaagatcctgcccttccaggtgctgagcacacgcaagcgcaaggatgtg
gaggtggcggacatcaaggtgcaggtgtgcctgttcgcctttgactgcctctacctcaac
ggcgccatgctcctgcagaagcccctcactgagcgccgcaccgccctctcccaagccgtc
cgcgagaagcccggagagctgcagtttgccctcttcaaggcacattcttatacatccact
gatgttgaagagctgggaacctttctgaacgagtcggtggcggcgggcacggaggggctg
attgtgaagacgatggacagcacctatgagccgtccaggcgctccctgcactggctcaag
ctcaagaaggattacctggagggcgtgggtgacaccctcgacgtggctgtcatcggcgcc
tggttcggcaaggggaagcggtcaggggtgtttggggcgttcctgctggcggtgtacaat
ccggagggcgaggagttccagaccatctccaagatcggcacgggcttctccgaggagcag
ctgaagcagttcagcgaggagctgcgcctgcacaccatccccaccgccaagccctactac
cggtactcagagacactgctgccggacatctggtttgacgcaaagacggtgtgggaggtc
aagtgcgctgacttcagcatctcgccgcgacacaaggcggcactgggattagccgaccct
gacaagggtatctcaatccgtttcccccgcctcgtcaaagtccgcgatgacaaaacaccc
gaggacgccacctcagccgaacaggttgcagaaatgtacttcaagcaggcgctgacatca
gggcagcagaagggaaagcaggaggacgaggaatga

DBGET integrated database retrieval system