KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_27656Help
Entry
COCSUDRAFT_27656  CDS       T02914                                 

Definition
(RefSeq) DAO-domain-containing protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00564  Glycerophospholipid metabolism
csl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    COCSUDRAFT_27656
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     COCSUDRAFT_27656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA FAD_binding_3 Pyr_redox_2 Pyr_redox_3 HI0933_like NAD_binding_8 Pyr_redox Spermine_synth GMC_oxred_N
Motif
Other DBs
NCBI-GeneID: 17044118
NCBI-ProteinID: XP_005650658
JGI: 27656
UniProt: I0Z645
LinkDB All DBs
AA seq 620 aa AA seqDB search
MSRFRTLVRGGLVLVSAGAGAAAISAFYNSKRPDAAHQTAGLFLLDEVPSRQQQLQHLAN
GTADNPYDLLIIGGGATGTGCAVDAATRGLQTALVEREDFASGTSSKSTKLVHGGVRYLE
KAVFNLDYGQLKLVFEALHERKRLLQNAPHLSSALPIMTPCYKWWEVPYYWAGLKAYDLV
AGTQGLTLSRYTTPAESRRQFPTLAKHGPDHSSLKGTIVYYDGQFDDSRLNVSLACTAAM
AGATVLNYAEVTRVIKDETGRVVGATVKDVLGRKSHDVYARQVINATGPFSDGIRHMSEP
EAPKMIMASAGVHVTLPDYYSPDHLGMIVPKTKDGRVVFMLPWLEATIAGTTDSSSEITM
RPQPTEEEIQFILDAISEYLTVEVRRSDVQSAWSGLRPLAVDPNAKDTASASRDHIVTQD
PDGLITVTGGKWTTYRLMAEDAIDKALATGRLHAAGPCRTHNLPLVGAAGYTPALFTDVA
QHYKVPHRPGAIDTSVARYLAAAYGDRAKVITHIAEEKKLGKRLVRGHPMIEAEVVYAVH
NEYCEHPEDFIARRTRLAFVDTAAAEQALPKIVELMAKEKGWWWGRRRAETKRAQDYLAT
FQSRPEPAGGVTVGDSPSAP
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatttcgcacccttgtgcgcggaggactcgtgctcgttagtgcaggtgcaggt
gctgcggctatatcagcattttacaactctaaaagacctgatgcagctcatcaaacggca
ggattgttcctcttggacgaggttccgtccagacagcagcagcttcagcacctggcaaat
ggaacggcggacaatccctacgatctcctcatcattggaggtggagccaccggcaccggt
tgtgcagtggatgccgctaccaggggtctgcaaactgcactggtggagagggaggacttt
gcttcggggacctcctccaaaagcacaaagctagtgcatgggggcgtgaggtatttggag
aaggcagtgttcaacctggactacgggcagctcaagcttgtctttgaggccctgcacgag
cgcaagcgcctgctgcagaacgccccccacctcagcagtgcattgcccatcatgacgccg
tgctacaagtggtgggaggtgccctactactgggcggggctcaaggcctatgacttggtg
gcgggcacacagggcctcaccctgtcgcgctacaccacaccggccgagtcgcgccggcag
tttcccaccctcgccaagcacggccctgaccacagctccctcaagggcacgattgtgtac
tacgatgggcagtttgatgactcgcggctgaatgtgagcctcgcctgcacggcggccatg
gctggagcaacggtcctcaactatgcagaagtgacccgcgtcatcaaggacgagactggg
cgagttgtcggggccactgtgaaggatgtgcttgggagaaaatcacatgatgtatacgct
cgccaggtgatcaacgcaactgggcccttctctgacggcatccggcacatgtcagagccc
gaggcgcccaagatgatcatggcgagcgcgggcgtgcatgtgaccctgccggactactac
tccccggatcacctgggcatgattgtgcccaagaccaaggatggcagggtggtcttcatg
ctcccctggctcgaggccaccattgcaggcaccactgacagcagctcggagatcacgatg
cggccgcagccgacggaggaggagatccagtttatcctggacgccatctccgagtatctg
acagtggaggtgcgccgcagcgacgtgcagagcgcctggagcgggctgcggcccctagct
gtcgaccccaatgcgaaggacactgcctctgcctcgcgggaccacattgtcacccaagac
cccgacggcctcatcactgttacaggcggcaagtggacgacctaccggctgatggcagag
gatgcgattgacaaggcgctggcgacagggcggctgcacgcggccggcccctgccgcacg
cacaacctgcctctggtgggcgccgccggatacacccccgcgctgttcacggacgttgcg
cagcactacaaggtcccccatcgcccgggtgccattgacaccagtgttgcgcgctacctc
gcagccgcgtacggggaccgggccaaggtgataacgcacatagcggaggagaagaagctg
ggcaagcgcctggtgcgtggccaccccatgatcgaggcggaggtggtctacgcggtgcac
aacgagtactgcgagcaccccgaggacttcatcgcacgccgcacgcgcctcgccttcgtc
gacaccgccgctgcggaacaggcactgcccaagatcgtggagctgatggcgaaggagaag
ggctggtggtggggcaggcgccgcgcagagaccaaaagggcgcaggactatctggcaacc
ttccagagccgccctgagccggccgggggtgtcacagttggagacagccccagcgctccc
tga

DBGET integrated database retrieval system