KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_28437Help
Entry
COCSUDRAFT_28437  CDS       T02914                                 

Definition
(RefSeq) glycoside hydrolase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00500  Starch and sucrose metabolism
csl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COCSUDRAFT_28437
Enzymes [BR:csl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     COCSUDRAFT_28437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 17042913
NCBI-ProteinID: XP_005649456
JGI: 28437
UniProt: I0Z2P3
LinkDB All DBs
AA seq 493 aa AA seqDB search
MQVSGRALASGGCSCSTIPHQFGRQVLAFQTKARVQSKRVSAQRTVAASTPVATAEKKLK
KTASKVADTAKDVADKVVGVSKPDLSKVVLLQAFGWDSCDKGGWYKIVKEKIPDIKASGV
THVWLPPPSQSVSRQGYLPGQLYNLQSLYGSEEELKELLAALKEAGLVPVADIVINHRCA
DAQDENGVWNNFRDDVSHSGEKIDWGQWAITGNDPEFGGTGNPDTGDDYGPAPDLDHLNE
DLRSHLKDWLNHLKEDIGYEGWRFDFVKGYGPEFIKEYVLETVGEGTFNVGEYWVDLRWN
GAELDYNQNDARQTIVNWIDGAGGASAAFDFPTKGILQEAVKNCQYWRLRDENNKPPGVI
GYWPEQSVTFIDNHDTGSTQQHWPFPDSHVDLGYAYLFTHPGNPTIFWDHYFDNGYKGVI
DQLIELRKRAGITAGSNIEILAADHDFYVARINDNVTIKMGPRYDMGDLLPKEEDGWKFA
VSGTDFGIWEKTA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtttcagggcgcgcgctcgcgtctgggggttgctcctgctccaccatcccgcac
caatttggcaggcaggtattggctttccaaacgaaggcacgggtccaatccaagcgggtg
tctgctcagcgcactgtggctgccagcaccccagtcgccaccgccgagaaaaagctgaag
aagacagcatcgaaggtagcagacacggccaaggatgtggcggataaggtcgtaggagtc
agcaagccagacctgagcaaggtggtgctcctacaagcattcggatgggacagctgcgac
aagggcggctggtacaaaatcgtgaaggagaagattcccgacatcaaggcatctggagtg
acgcatgtgtggctgccacccccgagccagtctgtgtctcgccaaggctacttgcctggg
cagctgtacaacctgcagagcctctatggcagcgaagaggagctgaaggagcttctggca
gccctgaaggaggccggtctggtcccagtggcagacattgtcatcaaccaccgctgcgct
gatgctcaggacgagaacggggtctggaacaacttcagggatgatgtcagccactctggg
gagaagattgactggggccaatgggccatcacaggcaacgacccagagtttggcggcact
ggcaatcccgacaccggcgatgactacggcccggcccccgatctggaccacctgaacgag
gacctgcgctcgcacctgaaggactggctgaaccacctgaaggaggacatcggctatgag
ggctggcgctttgactttgtcaagggctatggcccggagttcatcaaggaatacgtcctg
gagactgttggcgagggaactttcaatgttggcgagtactgggtcgacctcaggtggaac
ggcgctgaactggactacaaccagaacgacgcacggcagacaattgtcaactggatcgac
ggtgccggcggcgcgtcggccgcctttgatttcccgaccaagggaatcctgcaggaggct
gtcaagaactgccagtactggcgcctgcgcgatgagaacaacaagccgcccggagtcatc
ggctactggcctgagcagtccgtgaccttcattgacaaccacgacaccggcagcacgcag
cagcactggcccttccctgactcgcacgtggacctgggctatgcctacctgttcactcac
ccgggcaaccccaccatcttctgggaccactactttgacaacggctacaagggcgtaatc
gaccagctgatcgagctgcgcaagcgcgccggcatcacggcaggctccaacatcgagatc
ctggctgccgaccatgacttctacgtcgcgcgcatcaatgacaatgtcaccatcaagatg
ggcccccgctacgacatgggggacctgctgcccaaggaggaggatggctggaagtttgct
gtcagcgggacagactttggcatctgggagaagaccgcctga

DBGET integrated database retrieval system