KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_31327Help
Entry
COCSUDRAFT_31327  CDS       T02914                                 

Definition
(RefSeq) glutathione S-transferase
Organism
csl  Coccomyxa subellipsoidea
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N GST_N_3 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 17037211
NCBI-ProteinID: XP_005643582
JGI: 31327
UniProt: I0YKW9
LinkDB All DBs
AA seq 215 aa AA seqDB search
MAAQRTIWWGSGSAPAWRVLIGLKEKGLEYDSKLIEFSKKEHKSEDILRLNPRGQVPTFL
DDGVVVNESLAALLYLQDKYPEPSLLPATIEGRALVYQRFQEAANFHDKVSQVIRFKWTN
ADEALPQDKLDALQAELELWESYLSEDSFIAGPDFTLADISFGPFLLVFKRFGGTLKDFP
KLNKYAEKIEARPSFEDSYPPHWKETPGKDWLDSL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcagcggacaatctggtggggcagtggctctgctccagcatggagggtgctc
atcggcctcaaagagaaggggctggagtacgacagcaagctcatcgaattttccaaaaag
gaacacaagtcggaggatatcctgaggctgaaccccaggggccaagtgccaactttcctg
gacgatggcgtcgttgtgaacgagtccctggccgccctgctgtatctccaggacaagtac
cccgagccatccctgctgcctgccaccatcgagggccgtgccctggtgtaccagcgtttc
caggaggctgcaaacttccacgacaaggtcagccaggtcatccgcttcaagtggacgaat
gctgatgaagcgttgcctcaggacaagctggacgcgctacaggcagagctggagctttgg
gagagctacctgagcgaagacagcttcattgcaggccctgacttcacactggcagatatc
tcattcggaccgttcttgctggtgttcaagcgctttggaggcaccctgaaggacttccca
aagctcaacaagtacgctgagaagatcgaggctcgcccctcctttgaagacagctacccg
ccgcactggaaggagactcctggcaaggactggctcgacagcctgtga

DBGET integrated database retrieval system