KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_53616Help
Entry
COCSUDRAFT_53616  CDS       T02914                                 

Definition
(RefSeq) sorbitol related enzyme
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00040  Pentose and glucuronate interconversions
csl00051  Fructose and mannose metabolism
csl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COCSUDRAFT_53616
   00051 Fructose and mannose metabolism
    COCSUDRAFT_53616
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     COCSUDRAFT_53616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 17040634
NCBI-ProteinID: XP_005647191
JGI: 53616
UniProt: I0YW78
LinkDB All DBs
AA seq 340 aa AA seqDB search
MRFENFPLPDRTPPGNVRVEIKAVGICGSDVHYWRKGRIADFVLTDPMVIGHESAGTVVE
VGDDVTRLKVGDRVALEPGVPCWSNPACREGRYNLDPDIRFFATPPHHGSLAQFVDHPAD
FCFRLPEHLTHEEGAMVEPLSVGVHAVRRAGVSPGKTVAIMGAGPIGLMTLMAVKAFGAD
AVAITDIKRDNLDLAMKLGADVALNPDRDAAPQEVATWMRAALPPNGPDIVIDCAGFEPT
LQASIYSVISGGKVISVGMGCDHAHLPLSTINCKEIDLMGSFRYANTYPLCLNLMASKKV
DVMPLITHRFGFSPEDVAAAFDCAARSAETRAIKVMFNLP
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgaaaacttccccctgccagacagaacacctccggggaatgtgagggtggag
atcaaggccgtgggaatttgtgggagcgacgttcactactggcgaaagggtcgcatagcg
gattttgtgctgacggatcccatggtgatcggtcacgagtctgctgggactgttgtggag
gttggcgatgatgtgacgcgattaaaagtgggagatcgtgttgctttagagccaggggtg
ccctgttggtccaaccctgcctgtagggaaggaagatacaaccttgacccagacatccgc
ttctttgccactccgccacaccacggctcccttgcacagttcgtggaccacccagcagac
ttctgcttccgtttgccagagcacctgacacacgaggagggcgcgatggtggaaccgctg
tctgtgggcgtgcatgctgtgcgccgcgccggcgtctctcccggcaagactgtcgccatc
atgggcgccggccccattgggctgatgacgctgatggcagtgaaggcgtttggcgcggac
gcggtggcaatcacggacatcaagcgcgacaatctggacctggccatgaagctgggcgct
gacgtggcgcttaaccccgaccgcgacgccgcgccgcaggaagttgccacctggatgcgc
gccgccctgccgcccaacggacctgacattgtcatcgactgcgccggctttgagcccact
ctgcaggcctcaatctactctgtgatctcgggaggcaaggtcatctcggtgggcatgggc
tgcgatcatgcgcacctgcccctgtccaccatcaactgcaaggagatcgacctcatgggc
tccttccgctacgccaacacgtacccgctgtgcctcaacctgatggccagcaagaaggtg
gatgtgatgccgctcataactcaccgctttggcttcagcccagaggacgtggcagctgca
ttcgactgcgccgcgcgctctgctgagacacgcgccattaaagtcatgttcaacctgccc
tga

DBGET integrated database retrieval system