KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_54390Help
Entry
COCSUDRAFT_54390  CDS       T02914                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00020  Citrate cycle (TCA cycle)
csl00190  Oxidative phosphorylation
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
csl01200  Carbon metabolism
Module
csl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
csl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
csl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    COCSUDRAFT_54390
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    COCSUDRAFT_54390
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     COCSUDRAFT_54390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 17038065
NCBI-ProteinID: XP_005644633
JGI: 54390
UniProt: I0YNX0
LinkDB All DBs
AA seq 606 aa AA seqDB search
MAMLPAESSYPIIDHTYDAIVIGAGGAGLRATVGLCEAGFNAACITKLFPTRSHTVAAQG
GINAALGNMSEDDWRWHAYDTIKGSDWLGDQDAIQYMCREAPKAVTELENYGLPFSRTPE
GKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQSMKHDCQFFVEYFALDLI
MDDSGTCRGVMALCLEDGTLHRFRAAHTVLATGGYGRAYFSATSAHTCTGDGNAMAARAG
LPLQDLEFVQFHPTGIYGAGCLITEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVS
RSMTMEIREGRGCGPEKDHVYLHLNHLPPELLAERLPGISETAAIFAGVDVTKEPIPVIP
TVHYNMGGIPTNLRGQVVLPTKDNPDAIVPGLYAAGEAASASVHGANRLGANSLLDIVVF
GRACAITISEEGKPGESQPELAADAGQDTISRLDKLRHSQGPLSVAQIRSNLQKTMQADA
AVFRTQETLEEGCKKVDDIVESLNDVGLKDRSMVWNTDLVEAMELENLLINGAVTIHSAE
QRKESRGAHAREDFTTRDDKHWMKHTVGYFDYKAPGKDKVRIDYRPVHDQPMDSEMEHVP
PKARTY
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgttgcccgctgaatcgtcttacccgatcatagaccacacctacgatgccatt
gtcataggtgctggtggagcgggcctcagagctaccgtggggttgtgtgaggcaggcttc
aatgcagcgtgcatcacaaagctgtttcccacgcgttcccacacagtggcagcgcagggc
ggcattaatgccgcgctgggtaacatgtcagaggacgactggagatggcatgcgtatgac
accattaagggctctgactggctcggcgatcaggacgcaatccagtacatgtgccgcgag
gcgcccaaggcagtgacagagctcgagaactatgggctgcccttctcgcgcacgccggag
ggcaagatataccaacgcgcgtttggaggccagtccctggactttggcaagggcgggcag
gcatacaggtgtgcatgcgcggctgaccgtaccgggcacgccatgctgcacacgctgtat
gggcagagcatgaagcacgactgccagttctttgtggaatactttgcactggacctgatc
atggacgacagcggcacgtgccggggagtgatggcgctgtgcctggaggatggcacgctg
caccgcttccgcgcggcgcacaccgtgctagccaccggcggctacggccgcgcgtacttc
tctgcaacctcagcgcacacctgcaccggggacggcaatgccatggccgcgcgcgccggc
ctcccactgcaggacctggaatttgtgcagttccacccgacaggcatttacggcgcgggt
tgcctcatcacggaggggtcccgcggcgagggcggcatcctccgcaatagcgagggcgag
cgcttcatggaacggtacgcgccgacggcgaaggacctggcgtcgagggacgtggtgtcg
cggtcgatgacgatggagatccgcgaggggcgcgggtgcggccccgagaaggaccatgtg
tacctgcacctcaaccacctgccgcctgagctgctggccgagcgcctgcccggcatctcc
gagactgccgccatctttgccggcgtcgatgtcaccaaggagcccatcccggtgatcccc
acggtgcactacaacatgggcggcatcccgaccaaccttcgggggcaggtcgtgctaccc
acaaaggacaacccggacgccatcgtgccggggctatacgcggctggcgaggcggccagc
gcgagcgtgcacggcgccaatcggctgggcgccaactcgttgctggacattgtcgtcttc
ggccgcgcctgcgccatcaccatctccgaggagggcaagccaggagagtcgcagccggag
ctggcggcggacgctgggcaggacacgatctcacgtctggacaagctgcggcactcacag
gggcccctcagcgtggcccagatccgcagcaacctccagaagaccatgcaagcagatgcc
gccgtcttcaggacccaggagacgttggaggaggggtgcaagaaggtggacgacattgtt
gagtcgctaaatgacgtgggcctcaaggaccgttccatggtgtggaacactgacctggtg
gaggcaatggagctggagaacctgcttatcaacggcgcggtgacgatccacagcgcggag
cagcggaaggagtcccggggggcgcacgcgcgcgaagacttcaccacgcgcgacgacaag
cactggatgaagcacaccgtcggctacttcgactacaaggcgcccggcaaggacaaggtc
aggattgactacaggccggtgcacgatcagccgatggactcagagatggagcacgttcct
cccaaggccaggacatattga

DBGET integrated database retrieval system