KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_54894Help
Entry
COCSUDRAFT_54894  CDS       T02914                                 

Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00010  Glycolysis / Gluconeogenesis
csl00053  Ascorbate and aldarate metabolism
csl00071  Fatty acid degradation
csl00280  Valine, leucine and isoleucine degradation
csl00310  Lysine degradation
csl00330  Arginine and proline metabolism
csl00340  Histidine metabolism
csl00380  Tryptophan metabolism
csl00410  beta-Alanine metabolism
csl00561  Glycerolipid metabolism
csl00620  Pyruvate metabolism
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    COCSUDRAFT_54894
   00053 Ascorbate and aldarate metabolism
    COCSUDRAFT_54894
   00620 Pyruvate metabolism
    COCSUDRAFT_54894
  09103 Lipid metabolism
   00071 Fatty acid degradation
    COCSUDRAFT_54894
   00561 Glycerolipid metabolism
    COCSUDRAFT_54894
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    COCSUDRAFT_54894
   00310 Lysine degradation
    COCSUDRAFT_54894
   00330 Arginine and proline metabolism
    COCSUDRAFT_54894
   00340 Histidine metabolism
    COCSUDRAFT_54894
   00380 Tryptophan metabolism
    COCSUDRAFT_54894
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCSUDRAFT_54894
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    COCSUDRAFT_54894
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     COCSUDRAFT_54894
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LPD7 DUF1487
Motif
Other DBs
NCBI-GeneID: 17036503
NCBI-ProteinID: XP_005642984
JGI: 54894
UniProt: I0YJ71
LinkDB All DBs
AA seq 565 aa AA seqDB search
MRSTCQHAQIKSVHNGSNLHNGTHLLRCGKPAFRNHSQNGEPAPRRHAGPRKTLVLAQAA
TAEAVLQKADLHEDLKKALRSVKPKLLIDGEFVDAAGGETFPTEDPRTGDVLLDVAEAQE
RDVDRAVQAARKAFDHGPWPRMSGRERGLLIYKLADLMEEHLLELATLESLDNGKPLSVA
KSSDLPEAIEHLRYFAGWADKIHGLTIPTAGKMQAHTYREPLGVVGQIIPWNFPILMQAW
KLGPALAAGNTIVMKVAEQTPLSALRVGELALEAGIPPGVLNIIPGSGSVAGAALAKHKG
VDKIAFTGSTEVGKIIMKQAAENVVPVTLELGGKSPFVVCPDADLDAAVECAHQALFFNM
GQCCTAGSRTFVHESIYDEFVKRAVKRAAEKAVGDPFDESTEQGPQVSKEQFEKILSYID
KGQQEGAKLEYGGKRIGDKGYYVEPTVFSNVTDEMSIAKDEIFGPVQSILKWSTIGEVLE
RANATEYGLAAGVFTQNLNWATTLSRGLKAGTIWVNTWNTFDAGVPFGGYKLSGIGREHG
EAALSHYTQTKSVYQPLEEPLNWNM
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcggtccacgtgccagcatgcccaaattaagagcgtgcacaacggcagtaacttacac
aatggaacccatctgctgagatgcgggaagccagcattcagaaatcacagtcaaaacggt
gaacctgccccacgaaggcatgccgggccgcgcaagacgctggtgctagcgcaggctgcc
actgcagaagccgtattacagaaggcagatctccacgaggatctgaagaaagctttgcgc
agcgtaaaacccaagctccttatagatggagaattcgtggacgctgccgggggcgagacc
ttccccacagaagaccctcgaacaggagatgttctcctcgacgtggcagaggcccaagaa
cgggatgttgatcgtgctgtgcaggctgctcgcaaggcgttcgaccatggcccttggcca
aggatgtccgggcgtgagagggggctgctcatatacaagctggcagacctgatggaggag
catctgcttgagctggccacgctggagtcactcgacaacggcaagcccctctctgttgcc
aagagcagcgacctgccagaggcgattgagcacctgcgctattttgccggctgggccgac
aagatccacggcctcaccatccccacggccggcaagatgcaggcgcacacataccgggag
ccactcggtgtggtggggcaaatcatcccctggaacttccccatcctgatgcaggcctgg
aagctgggccctgctctggcggcaggcaacaccatcgtcatgaaggtggcagagcagacg
ccgctgagcgcgctgcgggttggtgagctggcgctggaggccggcattccaccgggcgtc
ctcaacatcattcccggcagcgggtcagtcgccggcgcagccctcgccaagcacaagggc
gtggacaagatcgcgttcactggcagcacggaggtggggaagatcatcatgaagcaggcg
gccgagaacgtggtgcccgtgactctggagcttggaggcaagtcgccgtttgtggtctgc
ccagacgctgacctggacgccgctgtggagtgcgcacaccaggcgctcttcttcaacatg
ggccagtgctgcacagcgggatcgcgaacttttgtgcacgagagtatctacgacgagttt
gtcaagcgggcagtgaagcgcgcagcagagaaggccgtgggtgaccccttcgatgagagc
accgagcaggggcctcaggtgtccaaggagcagtttgagaagatcttgagctacattgac
aagggccagcaggagggcgccaagcttgagtatggcggcaagcgcatcggggacaagggt
tactatgtggagccgacagttttcagcaatgtgacggatgaaatgagcattgcaaaagac
gagatcttcggccccgtccagtctatcctcaagtggtcgactatcggggaggtgttggag
cgggcgaatgccacagagtatggcctggcagcaggagtgttcacacagaacctgaactgg
gccacaacgctgtcccgaggactcaaggcaggcacgatctgggtgaacacatggaacaca
tttgacgcaggagtcccctttgggggctacaagctgagcggcatcggacgcgagcacggc
gaggctgcgcttagtcactacacccagaccaagtcagtgtaccagccacttgaagagccg
ctcaactggaacatgtga

DBGET integrated database retrieval system