KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_57819Help
Entry
COCSUDRAFT_57819  CDS       T02914                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    COCSUDRAFT_57819
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csl02000]
    COCSUDRAFT_57819
Enzymes [BR:csl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     COCSUDRAFT_57819
Transporters [BR:csl02000]
 Other Transporters
  Pores ion channels [TC:1]
   COCSUDRAFT_57819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_C GST_N GST_C_5 GST_C_3
Motif
Other DBs
NCBI-GeneID: 17038075
NCBI-ProteinID: XP_005644643
JGI: 57819
UniProt: I0YNY0
LinkDB All DBs
AA seq 262 aa AA seqDB search
MADEEFLELNTELTLLCSWFCPFAQRTWIALLEKGLPFAYKEVSLRNPDTGLWYPLTEKP
KWFTALNPLGKVPVLAYKDEKTQQPHSVYESLICNEFLEDYAPAPGHPPLLPPHPALRAK
ARIVMDHFNTRFVPLFYRILIRQDVGQQAEVAEQLQAECDWLEDNADQAGPFFMGTEFSL
VDCAMIPWFVRGYILKHFRQLELPPQRCTKLQRWVKAALERPSVKGTFQAPEEGTSYEDK
LLEHYVRYADGSANSTSAAAFK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgaagagttcctggaactgaacacagaactgacgttgctttgctcatggttc
tgccctttcgcgcagcgcacatggattgctctgttggagaaggggctgccgtttgcctac
aaggaggtcagcctgaggaacccagacactggtctctggtaccctctaactgagaagccc
aagtggttcactgccctcaatcccctgggcaaggtgccagtcttggcatacaaggatgag
aagacccagcagccgcacagcgtctatgagtccctcatctgcaacgagttcttagaggat
tatgcgccggcgcccgggcatcctccgctgctgccgccgcatccggcgctgcgggccaag
gcgcgtatcgtgatggaccacttcaacactcgcttcgtgccgctcttctaccgcatcctc
atcaggcaggacgtgggccagcaggctgaggtggcggagcagttgcaggcagagtgtgac
tggttggaggacaatgccgaccaggctggacccttcttcatgggcacagagttctccctc
gtggattgtgcgatgatcccctggtttgtgcgcggatacattctcaagcacttcaggcag
ctggaactgccgcctcaacgctgcacaaagctgcagcggtgggtgaaggctgcactggag
cgcccgtcagtgaaggggacgttccaggctccagaggagggcactagctacgaggacaag
cttctggaacactatgtgagatatgctgacggcagcgccaattccaccagtgcagcagcc
ttcaagtga

DBGET integrated database retrieval system