KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_60347
Entry
COCSUDRAFT_60347  CDS       T02914                                 

Definition
(RefSeq) alcohol oxidase
  KO
K22464  fatty acid photodecarboxylase [EC:4.1.1.106]
Organism
csl  Coccomyxa subellipsoidea
Brite
KEGG Orthology (KO) [BR:csl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    COCSUDRAFT_60347
Enzymes [BR:csl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.106  fatty acid photodecarboxylase
     COCSUDRAFT_60347
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C Lycopene_cycl NAD_binding_8 Pyr_redox_2 DAO
Other DBs
NCBI-GeneID: 17036293
NCBI-ProteinID: XP_005642926
JGI: 60347
UniProt: I0YJ13
LinkDB
AA seq 617 aa
MMASQSVFLGTRPATRSPLPIGRAGHGSAGRRALRVRAIIKSDNPAADKYDFILVGGGTA
GCVLANRLTADGSKKVLLLEAGGANKAREVRTPAGLPRLFKSALDWNLYSSLQQAASDRS
IYLARGKLLGGSSATNATLYHRGTAADYDAWGVPGWTSQDALRWFIQAENNCRGIEDGVH
GTGGLMRVENPRYNNPLHEVFFQAAKQAGLPENDNFNNWGRSQAGYGEFQVTHSKGERAD
CFRMYLEPVMGRSNLTVLTGAKTLKIETEKSGGATVSRGVTFQVNGQDGSKHSAELAAGG
EVVLCAGSIHSPQILQLSGIGPQAELRSKDIPVVADLPGVGQNMQDHPACLSAFYLKESA
GPISVTDELLHTNGRIRARAILKYLLFKKGPLATTGCDHGAFVKTAGQSEPDLQIRFVPG
LALDPDGIGSYTAFGKMKDQKWPSGITFQLLGVRPKSRGSVGLRSDDPWDAPKLDIGFLT
DKEGADLATLRSGIKLSREIAAEPAFGAYVGNELHPGAAASSDSAIDSFIRDTVHSGNAN
VGTCSMGVNGNAVVDPSLRVFGIRGLRVADASVIPVIPGGQTGAATVMVAERAAEILLGS
NQKQPAAAVPAAQPALA
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgatggcgagccaatccgtgttccttggcactcgaccagccacgcgctcccctctgccg
attgggagagctgggcatggatcagcaggaaggcgagcactgcgggtcagggcgataatc
aaaagcgacaatccagctgcagataagtatgacttcatcctggtcggcggcggcacagca
ggctgcgtgctggccaacaggctgacagcagatggatccaagaaggtcctgctgctcgag
gcgggaggcgccaacaaggcgcgggaggtacgcacaccggccgggctgccgcgcctgttc
aagagcgccctcgactggaacctctactcctccctgcagcaggcagccagcgacagatcg
atctacctggcacggggaaagcttctgggtggcagctccgcaactaatgccacgctgtac
caccgggggactgcggcagactacgacgcgtggggtgtgccggggtggacctcccaggac
gccctgcgctggtttattcaggcagagaacaactgcagagggattgaggacggggtgcat
gggaccgggggattgatgcgcgtggagaaccctcgctacaacaaccccctgcacgaggtc
tttttccaggcggccaagcaggccggcctcccagagaacgacaactttaacaactggggc
agatcacaggcggggtacggggagttccaggtgactcacagcaagggtgagcgcgccgac
tgcttccggatgtacctggagccagtcatggggcgttccaacctcacagtgctcaccgga
gccaaaacgctcaaaatcgaaactgaaaagtccggcggcgccacggtctcgcgcggcgtc
accttccaggtcaacggccaggacggcagcaagcactcagctgagctggcggctggcggc
gaggtggtgctgtgcgcggggtcaatccactcgccccagatcctgcagctctccggcatc
ggcccccaggcggagctgcgctccaaggacatccctgtcgtcgcagacctgcccggcgtc
ggccagaatatgcaggaccacccggcgtgcctgtcagccttctacctcaaagagagcgcg
ggtcccatcagtgtgactgatgagttgctgcacaccaatggccgaatccgcgcgcgcgca
atcctaaagtacctgctcttcaaaaaggggcccctcgccaccacaggatgcgaccacggc
gcctttgtgaagactgcaggtcagagtgagccggacctgcagatccgctttgtgccgggt
ctggcgcttgaccctgacggcatcggatcctacacggcctttggcaagatgaaggaccag
aagtggccctccggaatcaccttccagctgctcggagtgcggcccaagagccgcgggtcg
gtgggtcttcgcagcgacgacccctgggacgcgccaaaactggacatcggcttcctgact
gacaaggagggcgctgacctggccacgctgaggagcggcatcaagctctcgcgcgagatc
gcagcggagccggcattcggagcatatgtaggcaacgaacttcacccgggcgcagccgcc
tcgtccgattctgcgatcgactcattcatccgtgacacggtgcactcgggcaatgccaac
gtgggcacatgctcgatgggggtgaatgggaacgccgtcgtggacccgtcactcagagtg
ttcggcatccgcggcctgcgagtggccgacgcatcagtcatccccgtcatcccaggaggc
cagaccggcgctgcaacggtgatggtggcagagagggccgcggagattctcctcggctcg
aaccagaagcagccggccgccgccgtccccgccgcgcagccggccctggcttga

DBGET integrated database retrieval system