KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_60699Help
Entry
COCSUDRAFT_60699  CDS       T02914                                 

Definition
(RefSeq) ribose-5-phosphate isomerase
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00030  Pentose phosphate pathway
csl00710  Carbon fixation in photosynthetic organisms
csl01100  Metabolic pathways
csl01110  Biosynthesis of secondary metabolites
csl01200  Carbon metabolism
csl01230  Biosynthesis of amino acids
Module
csl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
csl_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
csl_M00165  Reductive pentose phosphate cycle (Calvin cycle)
csl_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
csl_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COCSUDRAFT_60699
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COCSUDRAFT_60699
Enzymes [BR:csl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     COCSUDRAFT_60699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC
Motif
Other DBs
NCBI-GeneID: 17043688
NCBI-ProteinID: XP_005650228
JGI: 60699
UniProt: I0Z4W5
LinkDB All DBs
AA seq 240 aa AA seqDB search
MATAEVKLSQDELKKQAAWKAVEYVTSGMKLGLGTGSTAAFAVDKIGQLLKDGTLKDIVA
VPTSIRTYEQALSLGIPLATLDEVSELDLAIDGADEVDPNLHVVKGRGGALLREKMVELA
SKKFVCIVDESKLVEGLGGSKDAMPVEIVQFCWKYNLNRLQNLPELTGNVAKLRMDGDKP
YVTDNSNYIVDLYFEDPIKDPHAAAEAISKLTGVVDHGLFLDMVDVCIVARSNGIEVMEK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcagaggtgaagcttagtcaggacgaattgaaaaagcaagctgcatggaaa
gctgtcgagtacgtgacgagtggcatgaagttgggccttgggactgggtccacagcagcc
ttcgccgttgacaagatcgggcagttgctcaaggatggtaccttgaaggacattgtagcc
gtcccgacatccatccgcacctacgagcaagccctcagtctgggcatcccactggcaact
ctggatgaggtgtctgagctggacctggcgatcgatggcgctgatgaggtggaccccaac
ctgcacgtcgttaagggccgcggaggagccctgctgcgtgagaagatggtggagcttgcc
tccaagaaatttgtgtgcattgtggacgagtcaaagctcgtggagggcctgggcggcagc
aaagatgcgatgcctgtggagatagtgcagttctgctggaagtacaacctcaaccggctg
cagaacctcccagagctcaccggcaatgtggccaagctgcgaatggacggcgacaagcct
tatgtcacagacaactccaattacatcgtggatctgtactttgaggaccccatcaaggac
ccccacgctgctgcagaggccatcagcaagctcacaggagtggtggaccatgggctcttc
ctggacatggtggatgtgtgcatcgttgcgcgctcgaatggcattgaggtcatggagaag
tga

DBGET integrated database retrieval system