KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_65594Help
Entry
COCSUDRAFT_65594  CDS       T02914                                 

Definition
(RefSeq) kinase-like protein
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
csl  Coccomyxa subellipsoidea
Brite
KEGG Orthology (KO) [BR:csl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csl01001]
    COCSUDRAFT_65594
Enzymes [BR:csl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     COCSUDRAFT_65594
Protein kinases [BR:csl01001]
 Serine/threonine kinases: AGC group
  PKA family
   COCSUDRAFT_65594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 DUF373
Motif
Other DBs
NCBI-GeneID: 17042920
NCBI-ProteinID: XP_005649463
JGI: 65594
UniProt: I0Z2Q0
LinkDB All DBs
AA seq 688 aa AA seqDB search
MEDLMDGQPIKRKLFSNKSLGNIRAALRRGNNDLLIEESSGSSPDLKTTLARQRFARMGL
AQTLSSASSGDLSELIPAQRATSEPRILGQLHKQPLNVLYPSLDGLELLRTLGTGSFGRV
RLVRCLSTGQFLALKALKKADVVRLNQQRHIANEKDILAAIHHPFIVDLHAVYSDATRVY
MLMGYVPGGELFSHLQKSPRRRLPAPAARFYAASVLLALEYLHERHIVYRDLKPENILLD
AAGYIKLADFGFAKILEEDRTYTMCGTPEYIAPEVIQMLGHTGAVDYWSLGVLIYEMLAG
APPFLAAQAAGQPGSRGATLDTYRKIIGGQLNFPAHITLPAKDLIRRLLAADPGTRLGSL
SGGAQDIKDHPFFQGLDWDALLRRELPAPIVPEVLRDGDASNFGLYSESVDVEVPASPHS
AEAADSFFRDWLHSAAEQGAGTGSGSQWLGAEVSPSSHRAPVANGRKSELSSTDDSSLFR
LSPGGPPSPPTAGGFPQSFADLSIDDVASSSARPSLRSMAYEQQVAAMGNLALIAYGVAF
VGSCLSWVLLLAGTGALYGVCPEACLYYFGLSWWSVCFQFIILLASVPVGALGAKSWKSA
VLALLAANTAVVMKQADGYLSLKETDPYYSSFPDRINTTITGFTLVSIFNVMLILAIGAV
DEECTKISAPQHSAYSNSEPAAYPRAGP
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggaagacctgatggacggccagcccatcaagcgcaagctgttcagcaacaagtctctg
gggaatatcagggcagctttgcgtcggggaaacaacgatctattgatcgaggagtcatcg
ggtagcagccccgacctcaagacgacgttggcgcgtcagcgcttcgccaggatggggctg
gcacagacgctgtcgtcggcaagctcgggagatctcagcgaactaataccagcccagagg
gccacatcggagccaaggatcctgggacagctgcataagcagccccttaatgtcctctac
ccgtccttggatggtctcgagctgctgcgcaccctaggtacggggtcatttgggcgggtg
cggctggtgcggtgcctgtctacggggcagttcctggcgctcaaggcactaaagaaagcg
gacgttgttcggctgaaccaacaacgccacatcgccaacgagaaggacatcctggccgca
attcaccaccccttcatcgtcgatttgcacgcggtgtacagcgacgcgacacgcgtctac
atgctgatgggctatgtccccgggggcgagctatttagtcacctgcagaagtcgccacgg
cgacggctgccggccccggccgcgcggttttacgcggccagcgtgctgctggccctcgaa
tacctgcacgaacgccacatcgtgtacagggacttgaagccggagaatattctgctggac
gctgccggctacatcaagttggcagactttgggttcgccaagatcctcgaggaggacagg
acgtacacaatgtgtggcacaccggagtacatagcgccggaggtgattcagatgttgggc
cacaccggggcggtggactattggagcctgggggttctaatctatgaaatgctggcgggt
gcccctcccttcttggctgcacaggccgccgggcagccgggcagccgcggtgccacgctg
gacacctaccgcaagatcatcggggggcagctcaactttcctgcccacatcaccttgcca
gcaaaagatctgatacggcggttgctggcggctgacccgggcacgcggctgggcagcctg
tcgggcggagcacaggacatcaaagaccaccccttcttccagggactcgattgggacgcc
ctgctaagacgcgagctgccggcgccgatagtgccggaggtcttacgcgacggggacgcg
tcaaacttcggcctctactcggagtcggtggacgttgaagtgcccgcctcgccgcacagc
gccgaagccgctgacagcttcttcagagactggctgcactccgccgcagaacagggcgcc
ggcacagggtcaggctcacagtggcttggcgcagaagtgagcccatcgtcccatcgggcg
ccggtggcaaacgggcgcaagagcgagctgtcatccacagatgacagcagcctattcagg
ctctcccccggggggcccccatcgccccccaccgccggggggttcccccagagctttgct
gacctcagcatcgacgatgtggcgtccagctcagcgcggccatcgctgcgcagcatggcc
tacgagcagcaggttgccgctatgggaaacctggcacttatcgcatatggagtggcattc
gtgggttcctgcctaagctgggtgctcctactggccggcaccggggcattgtatggcgtc
tgtccggaggcgtgcctgtactactttgggctttcgtggtggtctgtctgcttccagttc
atcattctgctcgccagcgtacctgtcggggcgttgggagcaaaatcgtggaagagtgca
gttctggcgctgctggcagcaaacactgcagtggttatgaagcaggcggatggatattta
tcgctgaaggagacagacccttactacagcagcttcccagaccgcatcaacaccaccatc
acaggtttcacactggtgtccatcttcaacgtcatgctgattctggcgatcggggcggtc
gatgaagaatgcacaaagatctccgcacctcagcactcagcatactccaactctgagcct
gcagcctacccgcgggcagggccctga

DBGET integrated database retrieval system