KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_83540Help
Entry
COCSUDRAFT_83540  CDS       T02914                                 

Definition
(RefSeq) hypothetical protein
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:csl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    COCSUDRAFT_83540
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csl03036]
    COCSUDRAFT_83540
   03400 DNA repair and recombination proteins [BR:csl03400]
    COCSUDRAFT_83540
Enzymes [BR:csl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     COCSUDRAFT_83540
Chromosome and associated proteins [BR:csl03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    COCSUDRAFT_83540
DNA repair and recombination proteins [BR:csl03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     COCSUDRAFT_83540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-GeneID: 17038439
NCBI-ProteinID: XP_005645166
JGI: 83540
UniProt: I0YQF3
LinkDB All DBs
AA seq 116 aa AA seqDB search
MTIKAFLGTYGTPSKVLEAPDEELESFIDPLGLQETRIKAVKQMSQAFFEKEWEDPVEFY
GCGKFTSDSWRIFCRGVKASKGVEDATLLRYLRWLNTGSLKDPKPARPRMPNAYAA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgacgataaaggccttcttggggacttatgggacgccatcaaaggtcttggaggctcca
gatgaggagcttgaaagcttcatagacccattgggtcttcaggagacacggatcaaggcc
gtcaaacagatgtctcaggccttcttcgagaaggaatgggaggatccagtggagttctat
ggctgtggtaagttcacatcggacagctggcgcatcttctgccggggggtgaaagcgagt
aaaggggtggaagatgcaactctgctgcgctacctcagatggctgaacactgggagcctc
aaagatccaaagcctgcaagaccaagaatgccaaatgcctatgcagcctaa

DBGET integrated database retrieval system