KEGG   Cyanobacterium stanieri: Cyast_0119Help
Entry
Cyast_0119        CDS       T02377                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00630  Glyoxylate and dicarboxylate metabolism
csn00710  Carbon fixation in photosynthetic organisms
csn01100  Metabolic pathways
csn01120  Microbial metabolism in diverse environments
csn01200  Carbon metabolism
Module
csn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
csn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
csn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyast_0119
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyast_0119
Enzymes [BR:csn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyast_0119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFZ46102
UniProt: K9YHZ3
LinkDB All DBs
Position
128339..128674
Genome map
AA seq 111 aa AA seqDB search
MQTLPKERRYETLSYLPPLTDQQIVKQVQYLLDQGFIPAVEFEKDPQPNDHHWTLWKLPL
FNAFSAQDVLNEVRECKGQYSDSFIRVIGFDNLKQCQTMSFIVHKPNTTRF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactttacctaaagagcgtcgttacgaaactctctcttacttacctcctttaacc
gatcaacaaatcgttaaacaagttcaatacttattagatcaaggatttattcctgcagta
gaatttgaaaaagatcctcaacccaatgaccaccactggactctttggaagttaccttta
ttcaatgctttctctgctcaagatgtattaaacgaagttcgtgaatgtaaaggtcaatat
tctgattctttcatcagagttatcggttttgataacctcaaacagtgtcaaaccatgagt
tttattgttcacaaacctaacaccactcgtttctag

DBGET integrated database retrieval system