KEGG   Cyanobacterium stanieri: Cyast_0334Help
Entry
Cyast_0334        CDS       T02377                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00010  Glycolysis / Gluconeogenesis
csn00020  Citrate cycle (TCA cycle)
csn00620  Pyruvate metabolism
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01130  Biosynthesis of antibiotics
csn01200  Carbon metabolism
Module
csn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_0334
   00020 Citrate cycle (TCA cycle)
    Cyast_0334
   00620 Pyruvate metabolism
    Cyast_0334
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cyast_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AFZ46314
UniProt: K9YHJ8
LinkDB All DBs
Position
complement(373723..374748)
Genome map
AA seq 341 aa AA seqDB search
MAEERTLPKFDHSTVKISKEESLVYYEDMVLGRLFEDKCAEMYYRGKMFGFVHLYNGQEA
VSSGIVKSLRANEDYVCSTYRDHVHALSSNVPAREVMAELFGKSTGCSKGRGGSMHMFSA
EHKLLGGYAFVAEGIPVATGAAYQTMYRRKALGDESSDQVTVCFFGDGASNNGQFFECLN
MAALWKLPVIYVVENNKWAIGMAHDRATSQPEIYKKASVFNMEGYEVDGMDVLAVRDVAQ
KAIARARAGEGPTLIEALTYRFRGHSLADPDELRDAKEKEFWNARDPIKKFAQYLTENNI
VTQAELDAIDKKVMETIEDAVKFAEESPEPDPSELYDYIFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaagaaccctaccaaaatttgatcattctacagtaaaaatttctaaagaa
gaaagtttagtttattacgaagatatggttttaggacgcttatttgaagataagtgtgct
gagatgtactacagaggcaaaatgttcggttttgttcacctctacaacggacaagaagcg
gtttctagtggtatcgtcaaatctttaagagctaatgaagattatgtatgtagtacctac
agagatcacgttcacgccctcagtagtaatgtccctgctagggaagtaatggcagagttg
tttggtaagtccacaggctgtagtaaggggcgtggtggctccatgcacatgttttctgca
gaacataagttattaggtggttatgcttttgtggcagagggtattcctgtcgccacaggg
gcggcttatcaaactatgtaccgtcgtaaggcattgggagatgaaagttcggatcaagta
acggtatgtttctttggtgatggtgcgagtaataatggacagttttttgagtgtttaaat
atggcggcgttgtggaagttgcctgttatttatgtggtagaaaataataaatgggccatt
ggtatggctcatgatcgcgcgacatcccagcctgaaatctacaaaaaagccagtgttttt
aatatggagggctatgaggtagatggtatggatgttttggcggtgcgtgatgtggctcaa
aaggcgatcgcccgtgctagggcaggagagggacctaccctcatcgaagccttaacctat
cgtttccgtggacactccctcgctgatcctgacgaattaagggatgcgaaggaaaaagaa
ttttggaacgcaagagatcccatcaaaaaatttgcccaatatctcactgaaaataatatc
gtaactcaagcagaactagatgcgatcgacaaaaaagtaatggaaaccatcgaggatgcc
gtaaaattcgccgaagaaagtcctgaaccagaccccagcgaattatacgactacattttc
gcttga

DBGET integrated database retrieval system