KEGG   Cyanobacterium stanieri: Cyast_0334Help
Entry
Cyast_0334        CDS       T02377                                 

Definition
(GenBank) pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00010  Glycolysis / Gluconeogenesis
csn00020  Citrate cycle (TCA cycle)
csn00620  Pyruvate metabolism
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01200  Carbon metabolism
Module
csn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_0334
   00020 Citrate cycle (TCA cycle)
    Cyast_0334
   00620 Pyruvate metabolism
    Cyast_0334
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cyast_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AFZ46314
UniProt: K9YHJ8
LinkDB All DBs
Position
complement(373723..374748)
Genome map
AA seq 341 aa AA seqDB search
MAEERTLPKFDHSTVKISKEESLVYYEDMVLGRLFEDKCAEMYYRGKMFGFVHLYNGQEA
VSSGIVKSLRANEDYVCSTYRDHVHALSSNVPAREVMAELFGKSTGCSKGRGGSMHMFSA
EHKLLGGYAFVAEGIPVATGAAYQTMYRRKALGDESSDQVTVCFFGDGASNNGQFFECLN
MAALWKLPVIYVVENNKWAIGMAHDRATSQPEIYKKASVFNMEGYEVDGMDVLAVRDVAQ
KAIARARAGEGPTLIEALTYRFRGHSLADPDELRDAKEKEFWNARDPIKKFAQYLTENNI
VTQAELDAIDKKVMETIEDAVKFAEESPEPDPSELYDYIFA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaaagaaccctaccaaaatttgatcattctacagtaaaaatttctaaagaa
gaaagtttagtttattacgaagatatggttttaggacgcttatttgaagataagtgtgct
gagatgtactacagaggcaaaatgttcggttttgttcacctctacaacggacaagaagcg
gtttctagtggtatcgtcaaatctttaagagctaatgaagattatgtatgtagtacctac
agagatcacgttcacgccctcagtagtaatgtccctgctagggaagtaatggcagagttg
tttggtaagtccacaggctgtagtaaggggcgtggtggctccatgcacatgttttctgca
gaacataagttattaggtggttatgcttttgtggcagagggtattcctgtcgccacaggg
gcggcttatcaaactatgtaccgtcgtaaggcattgggagatgaaagttcggatcaagta
acggtatgtttctttggtgatggtgcgagtaataatggacagttttttgagtgtttaaat
atggcggcgttgtggaagttgcctgttatttatgtggtagaaaataataaatgggccatt
ggtatggctcatgatcgcgcgacatcccagcctgaaatctacaaaaaagccagtgttttt
aatatggagggctatgaggtagatggtatggatgttttggcggtgcgtgatgtggctcaa
aaggcgatcgcccgtgctagggcaggagagggacctaccctcatcgaagccttaacctat
cgtttccgtggacactccctcgctgatcctgacgaattaagggatgcgaaggaaaaagaa
ttttggaacgcaagagatcccatcaaaaaatttgcccaatatctcactgaaaataatatc
gtaactcaagcagaactagatgcgatcgacaaaaaagtaatggaaaccatcgaggatgcc
gtaaaattcgccgaagaaagtcctgaaccagaccccagcgaattatacgactacattttc
gcttga

KEGG   Cyanobacterium stanieri: Cyast_2247Help
Entry
Cyast_2247        CDS       T02377                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00010  Glycolysis / Gluconeogenesis
csn00020  Citrate cycle (TCA cycle)
csn00620  Pyruvate metabolism
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01200  Carbon metabolism
Module
csn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_2247
   00020 Citrate cycle (TCA cycle)
    Cyast_2247
   00620 Pyruvate metabolism
    Cyast_2247
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cyast_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AFZ48196
UniProt: K9YMP5
LinkDB All DBs
Position
2489220..2490188
Genome map
AA seq 322 aa AA seqDB search
MFNALREAIDEEMARDESVFVLGEDVGHYGGSYKVTKGLYEKYGEFRVLDTPIAENSFTG
MAVGAAMTGLRPIIEGMNMGFLLLAFNQISNNAGMMRYTSGGNFKIPTVIRGPGGVGRQL
GAEHSQRLEAYFQAVPGLKIVACSTAYNAKGLLKSAIRDDNPVLFFEHVLLYNHKENLPE
DEYTLPLDKAEIVRKGKDVTILTYSRMRHHCTQALKQLEKEGYDPEIIDLISLKPLDMET
IGESIRKTHKVIIVEECMKSGGIGAELTASINDQLFDELDAPVVRLASQDIPTPYNGTLE
RLTIVQPNQIVEAVQKIMNNKI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacgctttgcgtgaagctattgacgaagaaatggcaagagacgaaagcgtattt
gtcctcggagaagacgtaggacattatggcggctcttacaaagttactaaaggactatac
gaaaaatacggtgaatttagagtattagacacccccatcgccgaaaatagttttacaggt
atggcagtaggtgccgccatgacaggattacgccccatcatagaagggatgaacatgggc
tttttactccttgccttcaaccaaatttccaacaacgcaggaatgatgcgctatacctct
gggggaaactttaaaattcctaccgttatcagaggaccagggggcgtaggtagacaatta
ggcgccgaacattcccaaagattagaagcctatttccaagccgtacccggtctaaaaatt
gttgcttgttccactgcttataacgccaaaggattattaaaatcagctattagagacgat
aaccccgttctattttttgaacacgttttattatataatcataaagagaatttacccgaa
gacgaatacaccttacctttagataaggcagaaattgtccgtaaaggaaaagatgtcacc
attttgacctattcgagaatgaggcaccattgcacccaagccctcaaacaactagaaaaa
gaaggttatgatcccgaaattattgatttaatttccctcaaaccccttgacatggaaacc
atcggcgaatccatccgtaaaacccacaaggttatcatcgtcgaagaatgtatgaagagt
ggcggtattggtgcagaattaaccgcatccatcaacgatcaactttttgatgaattagac
gcccccgtagtgcgtttagcttcccaagatattcctactccttataacggcactttagaa
agattaaccattgttcaacccaatcagattgtcgaagccgtacaaaaaattatgaataat
aaaatttaa

DBGET integrated database retrieval system