KEGG   Cyanobacterium stanieri: Cyast_0458Help
Entry
Cyast_0458        CDS       T02377                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00010  Glycolysis / Gluconeogenesis
csn00053  Ascorbate and aldarate metabolism
csn00071  Fatty acid degradation
csn00280  Valine, leucine and isoleucine degradation
csn00310  Lysine degradation
csn00330  Arginine and proline metabolism
csn00340  Histidine metabolism
csn00380  Tryptophan metabolism
csn00410  beta-Alanine metabolism
csn00561  Glycerolipid metabolism
csn00620  Pyruvate metabolism
csn00625  Chloroalkane and chloroalkene degradation
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_0458
   00053 Ascorbate and aldarate metabolism
    Cyast_0458
   00620 Pyruvate metabolism
    Cyast_0458
  Lipid metabolism
   00071 Fatty acid degradation
    Cyast_0458
   00561 Glycerolipid metabolism
    Cyast_0458
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Cyast_0458
   00310 Lysine degradation
    Cyast_0458
   00330 Arginine and proline metabolism
    Cyast_0458
   00340 Histidine metabolism
    Cyast_0458
   00380 Tryptophan metabolism
    Cyast_0458
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cyast_0458
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Cyast_0458
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cyast_0458
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Cyast_0458
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFZ46438
UniProt: K9YJZ3
LinkDB All DBs
Position
515452..516834
Genome map
AA seq 460 aa AA seqDB search
MTITSYSVQSFVDEQRKFFASGVTKSYDFRLQQLKKLKEAIALRQDKILEALHQDLGKPN
LEGCFELAVISEISYAIKNLKKWMKPKRVSAGIENFPACAKIHSEPLGVVLIIGPWNYPF
TLMISPLIGAIASGNCAMLKPSEIAPHTSALLTELIRDIFPPEYICIQEGGVELAQELLA
TKFDHIFFTGGTKIGQIVMEAAAKQLTPVTLELGGKSPCIVDKETNLKITAKRITWGKFI
NAGQTCIAPDYILVHQAIKQELIQEIKQCIHDFFGDSPAQSPDFARIINHKQFDRLEQLL
DSGNIIVGGKTDRENKYIAPTVLDNVTLNSPVMAEEIFGPIMPILEYTTLDEAIKIVNSK
PKPLALYFFSTNSDNKKRILHETSSGGLCFNETIMQVGVKDLPFGGVGDSGIGAYHGKTS
FDTFSHQKAVLSRFFWGDLDWRYAPYSEKMVNFFKKMYTK
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgactattactagctattctgtacaatcttttgtagatgaacaaagaaaattttttgct
tctggggtgacaaagtcctatgatttccgcttacagcagttgaaaaagctaaaagaggcg
atcgcccttagacaggataaaatattagaagccttacaccaagacttaggtaaaccaaac
ctagagggttgttttgaactagcagtaatttccgaaattagttacgccatcaaaaatctc
aaaaaatggatgaaacccaaacgggtaagtgcagggattgagaactttcctgcctgtgcc
aaaatacattccgaacctttgggagttgtattaatcatcgggccatggaattaccccttt
accctgatgatttctcccctcataggggcgatcgcctcgggaaactgtgctatgctcaaa
ccatcagaaatcgccccccatacctcagccctccttaccgaactaattagagatattttt
ccccccgaatatatctgcatccaagaaggaggagtagaactagcccaagaattactcgcc
accaaatttgaccatatattcttcacaggaggaacaaaaataggtcaaatcgtcatggaa
gccgccgccaaacaactaacccccgtcaccctcgaattaggcgggaaaagcccctgcatc
gtcgacaaagaaaccaacctcaaaattactgccaaaagaattacatggggtaaatttatc
aacgcaggacaaacctgtatcgcccctgactatatccttgtacaccaagccattaaacaa
gaattgatccaagaaatcaaacaatgtatccatgatttttttggggacagtccagcccaa
agccctgattttgcccgtatcatcaaccacaaacaatttgatcgactagaacaactctta
gacagtggtaatatcatcgtaggaggaaaaacagatcgagaaaacaaatatatcgcgccc
accgtcttagataacgtcactctcaactcccccgtcatggcagaggaaatttttgggccg
attatgcccatccttgaatatactacccttgatgaagccataaaaatcgtcaacagtaaa
cccaaaccccttgccctttatttcttctccaccaactcagacaacaaaaaaagaatttta
catgaaacctcatcagggggtttatgcttcaacgaaaccataatgcaagtaggcgtaaaa
gatttaccctttgggggggtaggagatagcggtattggggcatatcatggcaaaactagc
tttgataccttttcccaccaaaaagccgtcttatcccgtttcttttggggtgacttagat
tggcgttatgccccctatagtgaaaagatggttaactttttcaaaaaaatgtataccaaa
taa

DBGET integrated database retrieval system