KEGG   Cyanobacterium stanieri: Cyast_1915Help
Entry
Cyast_1915        CDS       T02377                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00970  Aminoacyl-tRNA biosynthesis
csn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csn00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cyast_1915
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:csn03029]
    Cyast_1915
Enzymes [BR:csn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cyast_1915
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cyast_1915
Mitochondrial biogenesis [BR:csn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cyast_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey ddrB-ParB
Motif
Other DBs
NCBI-ProteinID: AFZ47870
UniProt: K9YN84
LinkDB All DBs
Position
complement(2136162..2137649)
Genome map
AA seq 495 aa AA seqDB search
MSATATKTKYEAIIGLETHCQLNTKSKIFCSCSTEFDSPPNTNVCPVCLGHPGVLPVLNE
EVLNSAIKMGLALQGQIARYSKFDRKQYFYPDLPKNYQISQFDLPIVEHGKLEIELVDPK
TKEATRKTIGITRLHMEEDAGKLVHAGSDRLSGSTHSLVDFNRTGVPLLEIVSEPDLRSG
QEASEYVQELRRIVRYLGIGDGNMQEGSLRCDVNISVRPEGQQEFGVKVEIKNMNSFSAI
QKAIEYEIERQIEAIENGEPIIQETRLWEEGTGRTISMRVKEGSSDYRYFPEPDLPPLEI
TDAQLKALEQKLPELPAQKRSRYESEYGLSAYDARVLCDDRDVALYFEAVVSGGASAKGA
ANWVTQDIAAYLNSNLDLDITKIALKPEMLAELITLIENGTISGKIAKEILPELLEKGGS
PKQIVESKGLVSISDPDELAKIIDEVLAENPDKLEQFRAGKTKLQGFFVGQLMKKTGGRA
EPKLANQILNKKLNG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaacagctactaaaacgaaatatgaagcaattatcggtttagaaacccattgt
caactcaataccaagagcaaaattttctgtagttgttcgacggaatttgacagcccacct
aataccaatgtttgccctgtatgtcttgggcatccgggggttttgcctgtgttaaacgaa
gaggtgttaaactcggctatcaagatgggtttagccttacaaggacaaattgcccgttat
agtaaatttgatcgtaaacaatatttttatcccgatttacccaaaaactaccaaatttcc
cagtttgaccttcccatcgtcgaacatggtaaattagagattgaattagtagatcctaaa
accaaggaggccacccgcaaaaccatcggtatcactcgcctacacatggaagaggatgca
ggtaaattggtacacgcagggagcgatcgcctctcaggctcgacccattctctggtagac
tttaatcgtacgggtgttcccctgctcgaaatcgtttccgaacctgacttacgcagtggg
caagaagcctcggaatatgtgcaagaattgcgccgtatcgtccgttatttgggcattggt
gacggtaatatgcaagaaggttccctacgttgtgatgttaacatttccgtgcgtcctgaa
gggcaacaagaatttggtgtgaaggtagaaattaaaaatatgaactcctttagtgccatc
caaaaagccatcgaatatgagattgaaagacaaatagaggccattgaaaatggcgaaccc
atcatccaagaaaccagattatgggaagaagggacagggcgcaccatcagcatgagggta
aaagaaggctctagcgattaccgttatttccccgaacccgatttaccccccctcgaaatt
accgatgcccaactaaaagccttagagcaaaaattacccgaacttcccgcccaaaaacgt
agccgttatgaaagcgagtatggcttatctgcctatgatgctagggtattatgtgatgat
cgagatgtagctctgtattttgaagccgtagtatctgggggcgctagtgccaaaggtgct
gctaactgggtaactcaggacatcgccgcctatctaaacagtaatttagatttagatatt
acgaaaattgccctcaagcctgagatgttggcggagttaatcaccctcatcgaaaatggt
accattagcggtaaaatcgctaaggaaatcttacccgaattgttggaaaaaggtggttct
cctaagcaaattgtcgagagtaaaggcttagttagtatttcagatcctgatgagttagct
aaaatcattgatgaagtattggcggaaaatcccgacaaactcgaacagtttagggcagga
aaaaccaagttacaaggcttttttgttggtcaattgatgaaaaaaactggtggacgtgcc
gagcctaaattggcaaaccaaatcctcaacaagaagctaaacggttag

DBGET integrated database retrieval system