KEGG   Cyanobacterium stanieri: Cyast_2247Help
Entry
Cyast_2247        CDS       T02377                                 

Definition
(GenBank) Transketolase central region
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00010  Glycolysis / Gluconeogenesis
csn00020  Citrate cycle (TCA cycle)
csn00620  Pyruvate metabolism
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01130  Biosynthesis of antibiotics
csn01200  Carbon metabolism
Module
csn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_2247
   00020 Citrate cycle (TCA cycle)
    Cyast_2247
   00620 Pyruvate metabolism
    Cyast_2247
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Cyast_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: AFZ48196
UniProt: K9YMP5
LinkDB All DBs
Position
2489220..2490188
Genome map
AA seq 322 aa AA seqDB search
MFNALREAIDEEMARDESVFVLGEDVGHYGGSYKVTKGLYEKYGEFRVLDTPIAENSFTG
MAVGAAMTGLRPIIEGMNMGFLLLAFNQISNNAGMMRYTSGGNFKIPTVIRGPGGVGRQL
GAEHSQRLEAYFQAVPGLKIVACSTAYNAKGLLKSAIRDDNPVLFFEHVLLYNHKENLPE
DEYTLPLDKAEIVRKGKDVTILTYSRMRHHCTQALKQLEKEGYDPEIIDLISLKPLDMET
IGESIRKTHKVIIVEECMKSGGIGAELTASINDQLFDELDAPVVRLASQDIPTPYNGTLE
RLTIVQPNQIVEAVQKIMNNKI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacgctttgcgtgaagctattgacgaagaaatggcaagagacgaaagcgtattt
gtcctcggagaagacgtaggacattatggcggctcttacaaagttactaaaggactatac
gaaaaatacggtgaatttagagtattagacacccccatcgccgaaaatagttttacaggt
atggcagtaggtgccgccatgacaggattacgccccatcatagaagggatgaacatgggc
tttttactccttgccttcaaccaaatttccaacaacgcaggaatgatgcgctatacctct
gggggaaactttaaaattcctaccgttatcagaggaccagggggcgtaggtagacaatta
ggcgccgaacattcccaaagattagaagcctatttccaagccgtacccggtctaaaaatt
gttgcttgttccactgcttataacgccaaaggattattaaaatcagctattagagacgat
aaccccgttctattttttgaacacgttttattatataatcataaagagaatttacccgaa
gacgaatacaccttacctttagataaggcagaaattgtccgtaaaggaaaagatgtcacc
attttgacctattcgagaatgaggcaccattgcacccaagccctcaaacaactagaaaaa
gaaggttatgatcccgaaattattgatttaatttccctcaaaccccttgacatggaaacc
atcggcgaatccatccgtaaaacccacaaggttatcatcgtcgaagaatgtatgaagagt
ggcggtattggtgcagaattaaccgcatccatcaacgatcaactttttgatgaattagac
gcccccgtagtgcgtttagcttcccaagatattcctactccttataacggcactttagaa
agattaaccattgttcaacccaatcagattgtcgaagccgtacaaaaaattatgaataat
aaaatttaa

DBGET integrated database retrieval system