KEGG   Cyanobacterium stanieri: Cyast_2258Help
Entry
Cyast_2258        CDS       T02377                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00010  Glycolysis / Gluconeogenesis
csn00020  Citrate cycle (TCA cycle)
csn00260  Glycine, serine and threonine metabolism
csn00280  Valine, leucine and isoleucine degradation
csn00310  Lysine degradation
csn00380  Tryptophan metabolism
csn00620  Pyruvate metabolism
csn00630  Glyoxylate and dicarboxylate metabolism
csn00640  Propanoate metabolism
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01130  Biosynthesis of antibiotics
csn01200  Carbon metabolism
Module
csn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_2258
   00020 Citrate cycle (TCA cycle)
    Cyast_2258
   00620 Pyruvate metabolism
    Cyast_2258
   00630 Glyoxylate and dicarboxylate metabolism
    Cyast_2258
   00640 Propanoate metabolism
    Cyast_2258
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyast_2258
   00280 Valine, leucine and isoleucine degradation
    Cyast_2258
   00310 Lysine degradation
    Cyast_2258
   00380 Tryptophan metabolism
    Cyast_2258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csn04147]
    Cyast_2258
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     Cyast_2258
Exosome [BR:csn04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Cyast_2258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox FAD_oxidored GIDA FAD_binding_2 Pyr_redox_3 3HCDH_N K_oxygenase UDPG_MGDP_dh_N AlaDh_PNT_C Thi4 DAO
Motif
Other DBs
NCBI-ProteinID: AFZ48207
UniProt: K9YP39
LinkDB All DBs
Position
complement(2498253..2499671)
Genome map
AA seq 472 aa AA seqDB search
MSQFDYDLVIIGAGVGGHGAALHAVKMGLKTAIVEAGDMGGTCVNRGCIPSKALLAASGK
VRELADTSHLQDMGVNVGGVTFDRSAIASHANDLVSKIRGDLTNSLKRLKVDTIRGWGKV
VALQKVAVETESGEKTITARDIMLCPGSVPFVPRGVEIDGKTVYTSDHAVRLESLPQWIA
IIGSGYIGLEFADVYTALGSEITMIEAMDKLMPTFDPDIAKIAEKVLINSRDIETYTGVF
ATKVIPGTPVMIELTDAKTKEVVEVLEVDACLVATGRIPATQNMGLENLGIETERGFIPV
NDKMQVLKDGQVVPHLWAVGDANGKMMLAHAASGQGIVAVENMCGNDKTIDYRSIPAAAF
THPEISYVGLSEPQAKELGKNEGFEVATAKTYFKANSKALAEKETDGIAKVIYRKDTGEL
LGVHIIGIHASDLIQEAANAIASRQSVHELAFNVHAHPTLSEVLDEAYKRAS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatttgattatgatttagttattattggtgcaggtgtcggtggacatggtgcc
gctttacacgccgttaagatgggtttaaagactgccatcgtggaagcaggggatatgggt
ggtacttgtgttaaccgtggttgtatcccttctaaggcccttttggctgcttctggtaaa
gtaagggaattggcagatacttcccatttacaggatatgggtgtaaacgttggtggtgtt
acttttgaccgcagtgcgatcgcatcccatgccaatgatttagtgagtaagattagggga
gatttaaccaacagtttaaaaagattaaaggtagataccatcagaggatggggaaaagta
gttgcacttcaaaaagtggcagtggaaaccgaatcaggggaaaaaaccattaccgccaga
gatattatgctttgccccggctcagtgccttttgtgccaaggggtgtagaaattgatggg
aaaaccgtttatactagcgatcatgcggtgagattggaatctttaccccagtggattgcc
attattggtagtggttatatcggcttagaatttgcagatgtttataccgcccttggctca
gaaatcaccatgattgaagccatggataagttaatgcctacctttgatcccgatattgct
aaaattgcggaaaaggtactaattaacagccgtgacattgaaacctatacgggagttttt
gccaccaaggtaatccccggtacccctgtaatgattgagttaaccgatgctaaaaccaaa
gaagtggtggaagtgttggaagtggatgcctgtttagttgccaccgggcgcattcctgct
acccaaaatatgggcttagaaaatttgggcatcgaaaccgaaagaggttttatccccgtc
aacgacaaaatgcaagttttaaaagatggtcaggtagttccccatctttgggcggtgggt
gatgccaatggtaaaatgatgttggcgcacgctgcctctggacaaggtattgtggcggta
gaaaatatgtgcggtaatgataaaaccatcgattatcgtagtattcctgcggcggccttc
acccatcccgagattagctatgtgggacttagtgagcctcaagccaaggagttgggcaaa
aatgaaggttttgaggtagcgacggcgaaaacctactttaaggcgaattctaaggcgtta
gcagagaaagaaactgatggtatcgccaaggtaatttatcgtaaggacacgggggaactt
ttgggggtacatatcatcggtatccatgcttctgatttgattcaggaagcggcaaatgcg
atcgcctctcgtcaatcagtccacgaattagccttcaatgtccacgcccatcctaccctt
tctgaggtactcgacgaagcatataaacgcgctagttaa

DBGET integrated database retrieval system