KEGG   Cyanobacterium stanieri: Cyast_2511Help
Entry
Cyast_2511        CDS       T02377                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00010  Glycolysis / Gluconeogenesis
csn00020  Citrate cycle (TCA cycle)
csn00620  Pyruvate metabolism
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01120  Microbial metabolism in diverse environments
csn01130  Biosynthesis of antibiotics
csn01200  Carbon metabolism
Module
csn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_2511
   00020 Citrate cycle (TCA cycle)
    Cyast_2511
   00620 Pyruvate metabolism
    Cyast_2511
Enzymes [BR:csn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyast_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase
Motif
Other DBs
NCBI-ProteinID: AFZ48454
UniProt: K9YNK3
LinkDB All DBs
Position
complement(2754342..2755604)
Genome map
AA seq 420 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWEKAPGDKIEKGETVVVVESDKADMDVESFYSGYLATIL
VDAGQEAPVGAAIAYIAETEAEIEEAQKKASSAPSQSNGASAPKVEEKVEVATPEPTPTP
INKPSGRLIASPRAKKLAKELKVDLTTITGTGLNGRITAEDVEKVAGKAPSQPTVAPVSA
VTAPPSTPAQAPVNNLAGETVPLNTLQQAVVRNMMASLQVPTFHVSYDITTDALDTLYRQ
IKPKGVTMTALLAKAVALTLQKHPIVNSSYTDAGIKYNESINIAIAVAMPDGGLITPVLK
NADQVDIYSLARSWKDLVARARAKQLQPDEYSTGTFTISNLGMFGVSGFDAILPPGQGSI
LAVGGARPTVVSDGNGFFGVKNQMTVNITCDHRNIYGADAASFLKDLAQLIESETHSLTL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatatatttatgccagccctcagttctaccatgaccgaggggaaaatagtt
tcatgggaaaaagctcccggagataagattgaaaaaggagaaaccgtcgttgttgtggaa
tcagacaaagcggatatggatgtagaatctttttattctggttatttggcaactatttta
gtagatgcagggcaagaggcacccgtgggtgctgccattgcttatattgccgaaactgag
gcggaaattgaagaagctcagaaaaaagctagtagcgcccctagtcaatccaatggtgca
tcggctcccaaggtagaggaaaaagtcgaagtagcaacccctgaacctacccccaccccc
attaataaacccagtggcagattaatcgcttctccccgtgccaaaaaactagcgaaggag
ttgaaggttgatttaaccaccattacaggtactggtttaaatggacgcatcaccgctgag
gatgtggaaaaagtggcaggaaaagctcctagtcagcccactgttgcccctgtttctgcg
gtcacggctcccccctctactcctgctcaggctcctgtaaataaccttgctggggaaact
gtacccctcaatactcttcaacaggcagtggtaaggaatatgatggcgagtttacaggtg
cctaccttccatgttagttatgatattaccaccgatgcccttgataccctttatcgtcaa
attaagcccaagggtgtaaccatgactgcattactcgccaaggcggtagctctaactcta
caaaaacaccccattgttaattctagctatactgatgcgggtattaagtacaatgaaagt
atcaacattgcgatcgccgttgctatgccagatggtggtttgattacccctgtattgaaa
aatgctgatcaagtggatatttactcccttgcccgtagctggaaagatttagtcgccaga
gccagagcaaaacaattacaacctgatgaatatagcacaggcaccttcactatttctaac
ctaggaatgtttggcgtgagtggttttgatgctatcttacctcccggacaaggttctatt
ttagcagtagggggcgctcgtcctacggtagtatctgatggaaatggcttctttggagtt
aaaaatcaaatgaccgttaatatcacctgtgaccatcgtaatatctacggtgctgatgcc
gcttccttcctcaaggatttagctcagttaattgagtccgaaacccattccttgactctg
taa

DBGET integrated database retrieval system