KEGG   Clostridium cf. saccharolyticum K10: CLS_04360Help
Entry
CLS_04360         CDS       T02614                                 

Definition
(GenBank) 3-deoxy-D-arabinoheptulosonate-7-phosphate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
cso00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cso01100  Metabolic pathways
cso01110  Biosynthesis of secondary metabolites
cso01130  Biosynthesis of antibiotics
cso01230  Biosynthesis of amino acids
cso02024  Quorum sensing
Module
cso_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLS_04360
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CLS_04360
Enzymes [BR:cso01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     CLS_04360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: CBK76260
UniProt: D6DEY6
LinkDB All DBs
Position
complement(432589..433617)
Genome map
AA seq 342 aa AA seqDB search
MGFEYVSKLPTPDEIRAQFPLAPALAAEKARKDEEIKDVFTGKSSKFLVIIGPCSADRED
SVCEYVSRLAKVQDKVKDKLILIPRIYTNKPRTTGDGYKGLLHQPNPEKKPDLHEGLIAI
RKLHMRVIAETGFSTADEMLYPDNLTYLSDLLSYIAVGARSVENQQHRLVSSGVDVPVGM
KNPTSGALSVMLNAVHAAQHGHEFIYRSWEVKTKGNPLTHCILRGAVNKHNQCLPNYHYE
DLRLLLELYSERSLENPACIVDANHSNSNKQYMEQIRIVKEVLHSRRHSDDIRDFVKGVM
IESYLEPGCQKVGEHCYGKSITDPCLGWDDSERLLYDIAESI
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggatttgagtatgtcagcaaacttcccacgccggacgaaatccgggcccagttcccg
ctggctccggctctggcggcagagaaagccagaaaagacgaagagattaaagatgtgttt
acaggaaagagcagcaaatttctggtcattatcggcccctgctccgcagaccgggaggac
tccgtgtgtgagtatgtttcccgtcttgcaaaagttcaggataaagttaaggacaagctg
atcctgattccccggatctacacaaacaagccccggacaaccggtgatggatacaagggc
cttcttcaccagccaaacccggagaaaaagcccgacctccacgaagggttaattgccatc
cgcaaactccacatgcgcgtcatagcggaaaccggcttctccacggcagacgagatgctg
tacccggataacctgacctatctgtctgatcttttatcatacattgccgtaggtgcccgc
tcagtggaaaaccagcagcaccgcctcgtctccagcggcgttgacgtgcccgtgggtatg
aaaaatcccaccagcggcgctctctctgtcatgttaaatgccgttcacgcggcacagcac
ggccatgaatttatctacagaagctgggaggttaagacaaagggcaacccccttacccac
tgtattcttcgcggtgcagtcaataagcataaccagtgcctgcccaattaccactatgag
gatctgcgcctgctcctggagctctactcagagcgcagccttgaaaatcctgcctgcatt
gtagatgccaaccactccaattccaacaagcagtatatggagcagatccgtattgtgaag
gaagttctgcacagccgccgccactcagacgatatcagagattttgtcaagggcgtcatg
atcgagagctatctggaaccaggatgtcagaaggtaggagagcactgctacggaaaatcc
atcacggatccatgtctgggatgggatgattcggaacggctgctctatgatattgcagaa
agcatttag

DBGET integrated database retrieval system