KEGG   Clostridium cf. saccharolyticum K10: CLS_08590Help
Entry
CLS_08590         CDS       T02614                                 

Definition
(GenBank) Predicted amidohydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
cso  Clostridium cf. saccharolyticum K10
Brite
KEGG Orthology (KO) [BR:cso00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CLS_08590
Enzymes [BR:cso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     CLS_08590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: CBK76592
UniProt: D6DFW8
LinkDB All DBs
Position
832435..833295
Genome map
AA seq 286 aa AA seqDB search
MKQIRKYEAALIQMDTQNDKGENLKKARRFIEEAAAHGAKLICFPEVMNLIGKNTGEGGG
REEVPGYTSEILCEEAKKHGVYIHAGSITEQVPGQKRSRNLSFLINPEGEIIAGYRKLHM
FDITLSDGTPFRESDRVQGGEEIVTVETELGVFGMSVCYDVRFPELYRLMALSGAQVIFV
PSSFTMPTGKDHWEPLLRARAIENGCYIIAAGQTGTKPAYTAYGNSLVADPWGTVIARAR
DEECITYAQIDLDYLDKIREQLPSLENRRTDVYEVIYKKGSAAKGR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatcagaaaatatgaggcagctctcatccagatggatacccagaatgacaag
ggagaaaatcttaaaaaggcccgccgctttatagaggaggccgccgcccacggggcaaag
ctcatctgctttcctgaggtgatgaacctgattggaaagaatacaggagagggagggggc
agggaggaagttcccggctatacttcagagatcctgtgtgaggaggcgaaaaagcacggg
gtctacatccatgcgggcagcatcacagagcaggtgcccggacagaagcgatccagaaat
ctgagctttctcattaacccggagggagagattatcgccggttaccgcaagctccatatg
tttgacatcaccctttcagacggaactccgttcagggagtcggatcgggtgcagggggga
gaggagattgtcacagtggagacagagctgggggtgttcggaatgtctgtctgctatgac
gtgaggtttccggaactctaccgcctgatggccctttccggggctcaggtgattttcgtc
ccttccagctttaccatgcctaccggcaaggatcactgggagccgcttctcagagcccgt
gccattgaaaatggctgctacatcatagctgccggacagacagggacaaagccggcctat
acagcctacggaaacagtctggtggcagatccctggggaaccgttattgccagagccaga
gatgaggaatgtattacctatgcccagattgatctggactatctcgataaaatcagagag
cagctgccgtccctggaaaacaggcgcacggatgtgtatgaggtgatttacaaaaaaggc
agtgctgcgaaaggcagatag

DBGET integrated database retrieval system