KEGG   Clostridium cf. saccharolyticum K10: CLS_15840Help
Entry
CLS_15840         CDS       T02614                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
cso00010  Glycolysis / Gluconeogenesis
cso00030  Pentose phosphate pathway
cso00051  Fructose and mannose metabolism
cso00052  Galactose metabolism
cso00680  Methane metabolism
cso01100  Metabolic pathways
cso01110  Biosynthesis of secondary metabolites
cso01120  Microbial metabolism in diverse environments
cso01130  Biosynthesis of antibiotics
cso01200  Carbon metabolism
cso01230  Biosynthesis of amino acids
cso03018  RNA degradation
Module
cso_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLS_15840
   00030 Pentose phosphate pathway
    CLS_15840
   00051 Fructose and mannose metabolism
    CLS_15840
   00052 Galactose metabolism
    CLS_15840
  09102 Energy metabolism
   00680 Methane metabolism
    CLS_15840
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CLS_15840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cso01009]
    CLS_15840
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cso03019]
    CLS_15840
Enzymes [BR:cso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLS_15840
Protein phosphatases and associated proteins [BR:cso01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLS_15840
Messenger RNA biogenesis [BR:cso03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLS_15840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat LpxK
Motif
Other DBs
NCBI-ProteinID: CBK77166
UniProt: D6DHJ2
LinkDB All DBs
Position
1518793..1519767
Genome map
AA seq 324 aa AA seqDB search
MAKEVKTIGVLTSGGDAPGMNAAIRAVVRTAINKGLKVKGIMRGYAGLLQEEIVDMNGLS
VADIIGRGGTVLYTARCPEFTTAEGQQKGAEICRKHGIDGLVVIGGDGSFKGAGKLSALG
INTVGLPGTIDLDIACTDYTIGFDTAVNTAMDAIDRVRDTSTSHERCSIIEVMGRNAGYI
ALWCGLANGAEDILLPERYDGNEQELISRIIENRKRGKKHHIIINAEGIGHSASMARRIE
AATGIETRATILGYMQRGGAPTCKDRVYASIMGAKAVELLCAGKSNRVVAYKNGEYVDYD
IQEALNMNKDISEEQYNISKMLVR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaagttaagacaatcggcgttctcaccagcggcggcgacgcaccgggaatg
aatgcggcaatccgcgcggtagtcagaacagcaatcaacaaggggctgaaggtaaagggt
attatgaggggatacgccggacttctccaggaggagattgtggatatgaacggactcagc
gttgccgatattatcggtcgcggaggcacagtgctgtacacagccagatgccctgagttt
accactgctgagggccagcagaagggcgcggagatctgccgcaagcacggcatcgacggc
cttgtggtaatcggaggagacggttcctttaagggagccggaaagctgtctgccctgggc
atcaacacagtgggccttccgggaaccattgatctggatattgcctgcacggactatacc
atcggctttgacaccgcagtgaatacggccatggatgcaatcgaccgcgtgcgcgataca
tccacatcccatgagcgctgcagcatcatcgaggtaatgggccgcaacgccggatacatc
gccctctggtgcggtcttgcaaacggagcggaggacattctgcttccggagagatatgac
ggcaatgagcaggagcttatcagccgcattatcgagaaccgcaagcgcggcaagaagcat
cacattatcatcaatgccgagggaatcggacactctgcttccatggcgagaagaattgag
gctgccacaggaatcgagacaagggctaccatccttggctacatgcagaggggcggagcg
cctacctgcaaggacagagtatacgcatccatcatgggcgccaaggctgtggagcttctg
tgcgccggaaagagcaaccgggtagtggcatataagaacggagagtatgtggactatgac
attcaggaggctctgaacatgaacaaggatatttccgaggagcagtacaatatcagcaag
atgctggttcgctaa

DBGET integrated database retrieval system