KEGG   Clostridium cf. saccharolyticum K10: CLS_24750Help
Entry
CLS_24750         CDS       T02614                                 

Definition
(GenBank) ABC-type multidrug transport system, ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
cso  Clostridium cf. saccharolyticum K10
Brite
KEGG Orthology (KO) [BR:cso00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cso02000]
    CLS_24750
Transporters [BR:cso02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    CLS_24750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 RsgA_GTPase SRP54 AAA_27 DUF4162 AAA_22 AAA_15 AAA_30 DUF5380 AAA_33
Motif
Other DBs
NCBI-ProteinID: CBK77876
UniProt: D6DJK2
LinkDB All DBs
Position
complement(2371213..2372100)
Genome map
AA seq 295 aa AA seqDB search
MSKPVIVLNELTKSYGKHRGIENISFTVEQGEVFGFIGPNGAGKSTTIRTLMGLLKPSNG
GASIFGLDCSREPARIAKDVGYLPSENCYYNNMKVKEMLFYTAELYGVNAHSRMEELAER
LNLDLSRRIGDLSLGNKKKVGIVSALLPSPKLLIMDEPTSGLDPLIQQAFYDILKEENKR
GVTIFLSSHVLSEVQRLCDRVAILREGKLISVQSMKELRENGYKKISLTAKSAIPEDFFS
VPGTANLEWDKSKTSVSFMFSGPVMMIMNQLHRLELEDILIEEPSLEEVFLHYYE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagccggtaattgtcctaaacgaacttacaaaaagctatggaaaacatcgagga
attgaaaacattagctttactgttgaacaaggcgaggttttcggctttattggccccaat
ggagcaggaaaatctaccacaatccgtactctaatgggcctgctgaaaccctccaacgga
ggagcctctatctttgggttagattgtagtcgggagcccgcccgtatcgcaaaggatgtg
gggtatcttcccagcgaaaactgttactacaacaatatgaaagtaaaagaaatgcttttc
tacacagcagaactctatggtgtgaatgcccacagccggatggaagaattagcggagcgg
ttgaatttagacttatccaggcgaattggcgatttgtctttagggaacaagaaaaaagtt
ggcattgtgtcggctctgttaccctctccgaagttgctgattatggacgagcctaccagt
ggccttgacccgctcatccagcaggctttctatgatattctgaaagaagaaaacaaacga
ggtgtgaccatttttctgtcctcccacgttttgagtgaggtgcaaagactttgtgaccgt
gtagccattctgcgggaggggaagctgatcagtgttcaatccatgaaggaactgcgggaa
aacggatacaagaaaatctcgctgacagcaaaaagcgccattccagaggatttcttttct
gttcccggtacggctaatttagagtgggacaagagcaagacttctgtatcctttatgttc
agcggaccagttatgatgattatgaaccagcttcatcggctggagctggaggatatttta
attgaggaaccgtcattggaagaagtattcctccactactacgaatag

DBGET integrated database retrieval system