KEGG   Clostridium cf. saccharolyticum K10: CLS_27060Help
Entry
CLS_27060         CDS       T02614                                 

Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cso  Clostridium cf. saccharolyticum K10
Brite
KEGG Orthology (KO) [BR:cso00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cso01001]
    CLS_27060
Enzymes [BR:cso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CLS_27060
Protein kinases [BR:cso01001]
 Serine/threonine kinases: Other
  Bacterial family
   CLS_27060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like RIO1 Kdo APH
Motif
Other DBs
NCBI-ProteinID: CBK78057
UniProt: D6DK33
LinkDB All DBs
Position
complement(2572090..2574495)
Genome map
AA seq 801 aa AA seqDB search
MMLRPGMYLQDRYEILEQIGSGGMSEVYRAKCHKLNRLVAIKVLKEEFSSDAGFVKKFKM
EAQAAAGLSHPNIVSVYDVVDEGSIHYIVMELIEGITLKSYITKKGRLGSKEAIGIALQV
AQGIAAAHDQHIVHRDIKPQNMIISRDGKVKVADFGIARAVTTQTIGATAVGSVHYISPE
QARGGFSDSRTDIYSLGITMYEMVTGTVPFDGDNTVSIALAHLEQPITPPSRLNPEVPVS
LERIIMKCTQKKPEKRYADVYELISDLRHALVDPDDDFVAQEPEVDTSSPTMVISGDELS
QIKSAPRRSTGPIVMSGQSNSLRDVPGSGGQHERRGDREHGYDRRKEPESGRELKHSGYD
KNYDRDYERGHSGGYGRQDAAENGRDLDYDYEEDYGYDRGRSSGYGGSGSSRTSGGKKGG
RGGKSADVNPQIEKLLTTVGVAVAIIIVAVLVVIFAKLGGIFNSGSHTELTLPAVESGES
DSGLKDTETRVPDFVGMTEDEAEEKAKESHLKLSYSYTVSEEEKKGLVVEQKTEEGTVVD
KQSTIRVVVGEGGMESSTEEETDASQIDLTALGLEALDGTNAKNLLEAKGLKVSLQSENS
DTIIKDQVIRYEPTSASPGSEIRLYVSSGPAVTMVPVPDLTGKTEEEAAQLLEAAGLTVA
PKEQILTQKSDTVSRGKIISQIPLKDEEVPEGSAVSYVVSIGKGTKYVAIVNDDYPLKDN
FGPGGASTTITVEIVMVQTVNGQKRTTTVMDAREMKGDVTLPVHYQLTGEDGVLTGELQI
RDVTNDRVLKTYPLEFMEVDA
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttagaccgggaatgtaccttcaggatcgatatgagattcttgaacagattgga
tccggcggaatgtcagaggtctaccgggcgaagtgccacaagctcaacaggctggtggcc
atcaaggttttaaaagaagaattcagttccgacgcaggctttgtgaagaagttcaagatg
gaagcccaggcggcggcaggactctcccatccgaatattgtgagtgtctatgacgttgtg
gacgagggaagcatccattacattgtcatggagctgattgaggggatcaccttaaaaagc
tatattacgaaaaagggaaggctcggctccaaggaggccatcgggattgcgctccaggtg
gctcagggaattgcagccgcccacgatcagcatattgtccaccgggacatcaagcctcag
aatatgattatctccagggacgggaaggtaaaggtggcagatttcggcattgccagggct
gtcaccacccagaccatcggggcgacggctgtgggctctgtgcactatatctcgccggag
caggcgagaggaggcttcagcgattccagaacggatatttactctcttggaattaccatg
tatgagatggtgacgggaaccgttcccttcgacggagacaatacggtgagcatagcgctg
gcccatctggaacagcccatcaccccgccttccaggctgaatcccgaggtaccggtaagc
ctggagcgcattatcatgaaatgtacccagaagaagccggaaaagcggtatgcggatgtc
tatgagttgatctccgatctgcgccatgcccttgtggacccagatgacgacttcgtggct
caggagccggaggtggatacctcctcgcctacgatggtgatctctggggatgagctgagc
cagattaagagcgcgcccaggcgcagtaccggccccattgtcatgagcggccagagcaac
agtctccgggatgtgccggggtccggcggacagcatgagagaagaggagacagggagcat
ggctatgacagaaggaaggagccggaaagcggccgcgaactgaaacacagcggctatgat
aagaattatgacagagattacgagcgggggcactccggcggctacggacgccaggatgct
gcggagaacggaagggacctggactatgactatgaggaggactacggctatgacaggggc
cgcagctcaggctacggcggttccggctccagccggacttccggaggcaaaaagggcggc
agaggaggaaaaagcgcagatgtaaacccccagattgaaaaactgctcaccacggtcggc
gtggcagtggctatcattatcgtggcagtgctggttgtgatctttgcaaagcttggtggg
atttttaattccggttcccacacagagctgacgcttccggcggtggagtccggcgaaagc
gattcaggacttaaggacacggaaacaagggttccggacttcgttggaatgacagaggat
gaggcggaggagaaggcgaaggagagccatctgaagctgagctacagctatactgtgtcg
gaagaggagaagaaagggctcgtggtggagcagaagacagaagagggcactgtggtggat
aagcagtccacaatcagagttgtcgtaggtgagggcggaatggagtcctccacagaggaa
gagacagatgcgtcacagatcgatctgactgccctgggacttgaggctctggatggaaca
aatgccaaaaaccttcttgaagccaaaggccttaaggtatcgcttcagtctgaaaacagc
gacaccatcataaaggatcaggtgatccggtacgagccgacgagtgcctctcccggaagc
gagatccgtctgtatgtaagctcaggccctgctgttactatggtgccggtgcctgatctg
accggaaaaacagaggaggaggcggcacagcttctggaagcggcaggccttacagtagcg
ccaaaggagcagattctcacacagaagagtgatacggtttccaggggaaagatcatcagc
cagattccgctgaaggatgaggaggtgccggagggcagcgcagtcagctatgtggtaagc
atcggcaaggggacaaagtatgtggccattgtcaatgacgattatccccttaaggacaat
ttcggcccgggaggcgcttccaccacaatcacggttgagattgttatggtgcagacggtg
aatggacagaagagaacgacgacagttatggacgccagggagatgaagggagacgtcacg
cttccggtacattatcagcttacaggagaggacggagttctcacaggagagcttcagatc
cgcgatgtgacaaacgacagagtgctgaagacttatcctctggaatttatggaggtagac
gcatag

DBGET integrated database retrieval system