KEGG   Ceratosolen solmsi marchali: 105359438Help
Entry
105359438         CDS       T06056                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-like
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
csol  Ceratosolen solmsi marchali
Pathway
csol04120  Ubiquitin mediated proteolysis
csol04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csol00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    105359438
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105359438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csol04131]
    105359438
   04121 Ubiquitin system [BR:csol04121]
    105359438
Enzymes [BR:csol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     105359438
Membrane trafficking [BR:csol04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    105359438
Ubiquitin system [BR:csol04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    105359438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cbl_N3 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 Cbl_N2 zf-RING_4 zf-UDP zf-C3HC4_4 zf-rbx1 zf-RING_6
Motif
Other DBs
NCBI-GeneID: 105359438
NCBI-ProteinID: XP_011494352
LinkDB All DBs
Position
Unknown
AA seq 228 aa AA seqDB search
MCAQLMLFQPWSTLLRNWKILAVTHPGYVAFLTYDEVKVRLEKYSGKKPGSYVFRLSCTR
LGQWAIGYVTSDGQILQTIPHNKSLCQALLDGYREGFYLYPDGRNINPDLTWAVQPTPEE
HIKVTAEQYELYCEMGSTFQLCKICAEHDKDVRIEPCGHLLCTPCLTAWQDSEGQGCPFC
RAEIKGTEQIVVDPFDPRRTHRPGAQSASASNASTPTRDLDPDTEVSD
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgcacaattaatgttgttccagccatggtcaactttattacgcaattggaaaatc
ctagctgttacgcatcctggttacgtggctttcctaacttacgacgaagttaaggttcgg
ctggaaaagtacagtgggaagaagcccgggagctacgtattccggttgagctgcactagg
ctcggccagtgggccatcggctatgtcacctccgacgggcagatactccagaccatacct
cacaacaagagtctttgccaggcactgctagacggataccgggaaggattctatctctac
ccggatgggcggaatataaatccggacctgacgtgggctgtccagccgacgccggaggag
cacataaaagttaccgccgaacaatacgagctttattgcgaaatgggtagtacattccag
ttgtgcaagatttgtgccgagcatgacaaggatgtgagaatagagccctgtggacactta
ctgtgtacgccctgtctcaccgcctggcaggattctgagggccagggctgtcccttctgt
cgtgcggaaatcaagggcactgagcaaatagttgtcgacccgttcgatcctcgacgaacg
caccgaccgggagcccagtctgcctccgcgagcaacgcttcaacgcccacgagggatctg
gaccccgacaccgaggtatccgactag

DBGET integrated database retrieval system