KEGG   Ceratosolen solmsi marchali: 105359465
Entry
105359465         CDS       T06056                                 

Definition
(RefSeq) putative vacuolar protein sorting-associated protein 13C
  KO
K18496  fibroblast growth factor 1
Organism
csol  Ceratosolen solmsi marchali
Brite
KEGG Orthology (KO) [BR:csol00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csol04052]
    105359465
   00536 Glycosaminoglycan binding proteins [BR:csol00536]
    105359465
Cytokines and growth factors [BR:csol04052]
 Growth factors
  Growth factors (RTK binding)
   105359465
Glycosaminoglycan binding proteins [BR:csol00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105359465
SSDB
Motif
Pfam: FGF Menin
Other DBs
NCBI-GeneID: 105359465
NCBI-ProteinID: XP_011494381
LinkDB
Position
Unknown
AA seq 260 aa
MSLRWIHENLEPPNCDEESSDIDDSGSDDSYDSDVVLERSGCVGPGADDNVNYSNNNNAS
INANNANNANNANNANANANANNANANANANNNNNNQRTVSDQVDGDHQPCQLWLSRYPL
AEALDQSIEVRLFCRTGYFVGITRSGRVKGLQPSERTTIDNENVRLAVCPLTHRIIRLRS
VETGLYLAFNSTGHLYGEAKASKDNTEWEQWSIGEYDAFRSHKYADPGWWLGIKKIGRPQ
SGPRTAWGMKTVQFLTIRLS
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagcctgaggtggatacacgagaacctggagccgcccaactgcgacgaagagtccagc
gacatcgacgatagcggcagcgacgacagctacgactcggacgtcgtcctcgagcgatcc
ggttgcgttggccccggcgccgacgacaacgtcaactacagtaacaataataacgccagc
atcaacgccaacaacgccaacaacgccaacaacgccaacaacgccaacgccaacgccaac
gccaacaacgccaacgccaacgccaacgccaacaacaacaacaacaaccaacgtacggta
tccgaccaagtggacggtgaccaccagccgtgccagctgtggctgtcgcgttacccccta
gccgaggccctcgatcaaagcatcgaagtcaggctgttttgccggacgggctacttcgtc
gggataacgagatcgggacgcgtcaaggggctccagccgtccgagaggacgacgatcgac
aacgagaacgtgcgccttgccgtatgcccgctaactcatagaataatccgcttgcggagc
gttgaaactggactctacttggcctttaatagcacgggacacttgtacggagaggcgaag
gcgtcgaaggataacaccgagtgggagcaatggagcatcggcgaatacgacgccttccgc
tcgcataagtacgcggatcccggatggtggctgggcatcaagaagatcggaaggccacaa
tcgggaccgaggaccgcctggggcatgaagaccgtccagtttctaacgattcgactctcg
tga

DBGET integrated database retrieval system