KEGG   Ceratosolen solmsi marchali: 105366221
Entry
105366221         CDS       T06056                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K20017  Bcl-2 family protein
Organism
csol  Ceratosolen solmsi marchali
Pathway
csol04214  Apoptosis - fly
csol04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:csol00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105366221
   04215 Apoptosis - multiple species
    105366221
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 105366221
NCBI-ProteinID: XP_011502886
LinkDB
Position
Unknown
AA seq 272 aa
MDQSGSSRLSNLQVRTEETRSFRRGSLAANLIGLGGHPDAFDVARRRLSNVSDVVSRKIS
RTIGWRSLSVSVELTVSQGTSLCAQYMRNRLKRSGIFRRKLGLKRMRSAKLLSGGALVAE
VYPELAAVGTELERMHPKLFERVGRQIGCGAFRSEQRVTEALTDVAREMLRTGECSWEKI
VALYAIAGGMAVDCVRQGKPEFLVTIQRAMAMVLEEDLAAWIQANGGWNALIIRYRPVLK
QIGWQTNTVILFIAITTIFISILSTSIRIFLL
NT seq 819 nt   +upstreamnt  +downstreamnt
atggatcaatcaggttcctcgagactgtcgaacctacaagtgcgaacggaggaaacacgc
agcttccgtaggggaagtcttgcagcaaacctaatcggcctcggaggacatccagatgct
ttcgatgttgctcgacgcagattaagcaatgtcagcgatgtcgtttctcgaaaaatatcg
cgaactatcggatggcgctccttatcagtttccgtggagcttacggtttcacagggcaca
tcattgtgtgcgcaatacatgcgcaaccgacttaagcgctcgggtattttccgacggaag
ctcggcctaaagcggatgcggagcgcgaaactcctgtccggcggtgccttggtcgctgaa
gtttacccagagcttgcggccgtgggcactgagctcgagagaatgcatccgaagttgttc
gagagggtcggtcggcagatcggttgtggcgcctttaggagcgagcagcgggtgactgag
gccttgaccgatgtcgctcgggagatgctcaggactggagaatgcagctgggagaaaatc
gtcgccctgtacgcgattgccggaggcatggccgtcgactgcgtcagacagggaaaaccg
gagtttctcgttaccatacagcgagccatggcgatggtgctcgaagaagacctcgctgcg
tggattcaggccaacggtggatggaatgctttgattatacggtacagaccagtgctaaaa
caaataggatggcaaactaatacagtaattttattcatcgccataacaacaatatttatc
agcattctttcaacatcaatcaggatatttttattgtaa

DBGET integrated database retrieval system