KEGG   Corynebacterium simulans: WM42_0902Help
Entry
WM42_0902         CDS       T04316                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
csp  Corynebacterium simulans
Pathway
csp00473  D-Alanine metabolism
csp01100  Metabolic pathways
csp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    WM42_0902 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    WM42_0902 (alr)
Enzymes [BR:csp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     WM42_0902 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:csp01011]
 Precursor biosynthesis
  Racemase
   WM42_0902 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AMO88644
UniProt: A0A127NT01
LinkDB All DBs
Position
complement(932116..933210)
Genome map
AA seq 364 aa AA seqDB search
MLRTRIDLDAIAHNVSLLKKKVAPAQLMCVVKADAYGHGVKEVAPVMARAGADAFGVATF
EEAIELRRSGIDQPITAWIWDSTQEIAEALACRIHIAVPSLVHARRLVESEIPAQVYIKV
ETGLHRSGVEEANWDATFALLRDAPQVEVLGLMSHFACADEPDNPFNDEQEANFRRALER
ARAAGLECPVNHLANSPAVLDRPSSHFEMVRPGLACYGLEPIPGLEHGLKPAMTWAANVV
NVKPIQPGEGTCYNLTWKAEKPGFLATIPCGYADGLPRNFQGKLKVGIGGKLYPQVGRVC
MDQIVVDLGENEYSVEQGDEAIIFGEGGLSATDLAEATGTINYEIICRPAGRTARHFEGG
IGHA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgtaccagaatcgaccttgacgccattgcccacaatgtttctttgttaaagaaa
aaggtggctcccgcgcagctcatgtgcgtggtgaaagcggatgcttatggtcacggcgtc
aaagaagtcgcgccagtgatggcgcgtgcgggtgcggatgctttcggtgtggcgactttc
gaagaggccattgagctgcggcgcagcggaatcgatcagccgattacggcgtggatttgg
gactctacgcaggaaatcgcggaggccttggcgtgccgcatccacattgcagtgccctcc
ttggtacacgcgcgccgcttggtggaatcggagatcccggcgcaggtttatatcaaggtt
gaaaccggtctgcatcgctccggcgtggaggaagcgaactgggatgctactttcgcactg
cttcgcgacgcccctcaggtcgaggttctaggcctcatgtcgcattttgcgtgcgccgat
gagccagataatcccttcaacgatgagcaggaagctaattttcgccgcgcgctggaacgg
gcccgggctgcaggcctggagtgcccagtgaatcacttggccaactccccggctgttttg
gaccgaccttcttcccatttcgagatggtccgtccgggcttggcttgttatggcctggag
ccgatccccggcctcgagcacggtttgaagccggcgatgacctgggcggcgaacgtcgtc
aacgtcaagccgattcagccaggcgagggcacctgctacaacctcacgtggaaagccgag
aagccgggatttttggccacgattccgtgcggatacgccgacggtttgccgcgcaacttt
cagggcaagcttaaggtcggtatcggcggcaagctttacccacaggtgggccgcgtgtgc
atggaccagattgtcgtggacttgggcgagaacgagtacagcgtcgagcaaggcgacgaa
gccatcatcttcggcgaaggtggcctgagcgccacggatctggcggaggccaccggaacc
atcaattacgaaatcatctgccgtcccgccggccgcaccgcccgtcactttgagggagga
atcgggcatgcgtaa

DBGET integrated database retrieval system