KEGG   Corynebacterium simulans: WM42_1933Help
Entry
WM42_1933         CDS       T04316                                 

Definition
(GenBank) beta-ketoacyl synthase, C-terminal domain protein
  KO
K11533  fatty acid synthase, bacteria type [EC:2.3.1.-]
Organism
csp  Corynebacterium simulans
Pathway
csp00061  Fatty acid biosynthesis
csp01100  Metabolic pathways
csp01212  Fatty acid metabolism
Module
csp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:csp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    WM42_1933
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:csp01004]
    WM42_1933
Enzymes [BR:csp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     WM42_1933
Lipid biosynthesis proteins [BR:csp01004]
 Fatty acid synthase
  Bacteria type
   WM42_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1729 Acyl_transf_1 ketoacyl-synt Ketoacyl-synt_C MaoC_dehydratas DNA_pol_B_N Fas_alpha_ACP SAT FAS_I_H Binary_toxB_2
Motif
Other DBs
NCBI-ProteinID: AMO89640
UniProt: A0A127NVS5
LinkDB All DBs
Position
2016993..2026106
Genome map
AA seq 3037 aa AA seqDB search
MSTTPRTETTTIIQPHSTGKRLVNRLDAEPFALSFSGQGYAWLPNLQASIAAGAGTRLAG
HLKQAEKILEPLADDLAAAFPHGFAPLEWAAPANSPRINLADSAISTPGIVTAQVGVLEA
LSAQGLDVSQAVAAIGHSQGTLSTFVATGRAEAGEVIVLAQLIGAAITRTARTHGLVRNA
EGSPMVAVSGATQEQIEKAGGRIGLRNGRDKFIIVGTPAEVAAVQGRLEAAASKDAKLVE
SKQRGGAPFAPRFSQLDIQAAYHHPAMEEAVAQVIVWGKTAGLDPVLVEEGARAVLTDIV
DWPARVTEAIEAGARWIFECGPDGGVEPLTRDIVAGRGIGTLVVCGSQGQSQLFDAGQAP
ALPMSWERFRPTLRAGRLFTKFTEATGYSPVMLPGMTPSTVDPEIVAAAANAGHWAELAG
GGQTTNALLARNLEKLEELLEPGVNAQFNAMYLSASQWRRQIAGERALPKARANGAPING
VVVSAGIPPLDEAVELVESLHADNFPWVAFKPGTIKQIDQVLRIAEQAPGLIIMQVEGGH
AGGHHSWEDLDELLAATYGRIREHDNVVLAVGGGIGTPARGVQYLLGTWAHKQGLPDAPV
DAIMVGTAAMATKESTASESVKRALVAAQPTVQNDGWAGVGAAAQDFGGSVTSGLSQLGA
DIHEIDNSFARAGRLLDEVAGDAEAVAARRDEIIEAIGKTCKPYFGDLDSMTYAQWLERY
LELSYMGQWVDESWFQRFVAMVERTEARLNPADHGEIELQVTAERENPEQAVKQLRELLG
SAALDQLVHPGDAAWFLQLLNQKGKPANFVPVIDAEVRRLWRQDSLWQAHDERYDADQVC
IIPGTTAVGGIERADEPVAELLARFEQAATDELTQAGVQDKPEHSDFDTILKAPMVNWAG
REQLNPLRLVLSTGQFLAESIESKDNGSRFQKLAEGEYWLSVPLKGAIAGAQLRLRITPP
QIPGASPLITEADAAESMRELARVAAGGTLPEVTGGTAIWSGELSAADSADYENVTAGYA
PADALSADVAEGAHVAPDVLVGKAWPAVFAVIANAVTEDGTNVVEGLLNLVHLEHNLELK
SALPREAKLRITATAGEVRDTPVGRVVDVAVDIETATDGASVAGADTAGTPVARLFERFA
IQGRRGEQELGAADSVAGEASTTAEKPRSFRHEMTVTAPQSMHPFAVVTGDRNPIHVADL
AAQLAGLKDGVIVHGMWTSALAQLAAAFDGAAVREWSATMQAPVLPGAQVTFVVERVGLD
TRPGFGEVRAVTASVDGVPVLEARATVADKLTFYGFPGQGIQSQGMGMDAFAASSSARSV
WERADKHTRSKLGFSILEIVRNNPQSVTVRGEEFTHPDGALFLTQFTQVAMATLGCAQIA
EMQEAGVLDSGAYFAGHSVGEYNALAAYAQVLSLEAVVEIVYARGLTMHRLVERDAEGNS
NYGLAALRPNKIGVSAKDVFPYVAEISAQTGEFLEIVNYNIAGVQYAVAGTRAGLNALRA
DAERRAPGARAFIQIPGIDVPFHSSHLLGGVPAFREHLDSLIPADIDLDILVGHYVPNLV
ARPFELTEEFVQAIDSVVDSEPVKAILSDFAGALENPVQLGRTLLIELLAWQFASPVRWI
ETQDLLLSEPGTIGGAGTPGLGVGRFVEVGVGSSPTLANMLGQTLRLPQYAGHGIEVLNI
ERDRDVVFAEDAIARPEPEQTAAAQSGAEGGAVESDATAASLVPETSAAAETTTLVAPVP
APAAGGETPADKPLSAQFATEMLVAVWTKVRLDQMGPADTIELLVEGVSSRRNQLLLDLG
VEFGLGAIDGAADAALSELKETVAGMAKGYKAFGPVLGEQVADALRRLTGPAGKKPGYVA
ERVTGAWGLGEGWADRVIAELVLGTREGASLRGGDLATLGTGAANAKELDALIDAAVTAA
GQREGISIAMPSAGGAAGGGVVDSAALDAYTAEMTDTLAETARTLLSKLGVAAPATEFSE
VDENAALAELVSRELGSDWAKQVAPSFDADKAVLLDDRWASAREDLARVAAGELNAADVD
VLGAGEAVARLAEHFGLPDHAQEARVDAASLTMSNDVAVVTGGSPNSIAAAIIGELLNEG
ATVVATTSRLNHDRVEFYKELYRTHAAGSAALWVVPANLSSFKDLDALVEWIGNEQTATV
GGKSKLVKPALVPTLLFPFAAPRVQGTLADAGAQAESQMRLLLWSVEKLIAGLSQLGADT
HVGQRLHVVLPGSPNRGRFGGDGAYGEAKAALDALVTRWKAEPVWGERTSLVHAHIGWVR
GTGLMGGNDPMVELVEAKGVETYSTEEMAIKLVDGGANSDVREQAAQGPVTLDFTGGLGE
ADLNLPELAREATQRAEQTSASNGGVIRAPKTVQALPNPLSPLQWTTPDFSGVTQSFDDM
VVIVGAGELGPLGSSRTRFEVELSGELSAAGVLELAWTTGLIKWDAQSAQWIVLETGEAI
AEEDVYEQFHDQVMANIGVRRYHDDFGPHMPMVDNLAPELTTIYLEKPLTFTVDDEATAK
SFVEEVEGATAHFDGEEWQVTRPAGSPVRVPRRVAMSRFVGGQVPTGFDPAVYGIPADMI
DNLDRVALWNIVCTVDAFLSAGFSPAELLASVHPARVSSTQGTGMGGMASLRSLYVDKLL
AQSRPNDILQEALPNVVAAHVMQSYVGGYGQMVHPVAACATAAVSVEEAMDKLRLHKADF
VVAGGIDDLSIEGITGFGDMAATADSAEMEAKGIDHKYFSRANDRRRGGFIESEGGGTLL
LARGSFAAEQGLPVLGVVAFAESFADGAHTSIPAPGLGALSAARGGVDSRLAQALRAHGV
TPDEVSIISKHDTSTNANDPNESDLHERIAAAMGRNSGNPMYVISQKTLTGHAKGGAAAF
QMVGLTQVLREGILPPNRSLDCVDPVLAKHEHLVWLRHQLDLRGNQAKAPKAGLVTSLGF
GHVSALVAVVHPGAFLVALAAARGSDAATRWEARAQARERAGLRRIESAMRGGAALYERP
VDRNLGGTGDAVKEREARVLLDDSARLQGGVLSLGKG
NT seq 9114 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccaccccgcgtaccgaaactacgaccattatccagccgcattccacaggaaaa
cgcttggtcaaccgcctagacgccgaacctttcgcgctgtcattttcgggccagggctat
gcctggcttcccaatctgcaggcatccatcgccgcaggcgcaggcacccgccttgccggg
cacctgaagcaggcggaaaagatcctcgagccactcgcagacgatctcgccgccgccttc
ccgcacggctttgccccgctcgagtgggcagcaccagcgaactcgccgcgcattaacctg
gcggattctgctatctctaccccgggcatcgtcaccgcccaggttggtgtgctcgaagcg
ctttctgcccaggggctcgacgtctcgcaggcggtcgcggccattggtcattcccagggc
accttgagcacgtttgttgccaccggccgcgccgaagccggcgaggtcatcgttttggcg
cagctcatcggtgccgctatcacgcgtacagcccgcactcatggtttggtccgcaacgct
gagggttctcctatggtggcagtctccggtgccactcaagagcagattgaaaaggctggc
ggtcgtatcggcctgcgcaatggccgcgacaagttcatcatcgtcggtaccccggcggag
gtagccgcagttcaaggccgcctcgaagcggcggcctccaaggacgctaagctcgtcgaa
tccaagcagcgcggcggcgccccgttcgcacctcgctttagccagctcgacatccaggct
gcctaccaccacccggcaatggaagaggccgttgcgcaggtcatcgtgtggggtaaaacc
gcaggtcttgatcccgtgctcgtggaggagggcgcccgcgccgtcctcaccgacatcgtc
gattggccagcccgcgtcaccgaggccatcgaggcaggcgcccgctggatcttcgagtgc
ggccctgatggtggcgtcgagccgctgacccgagacatcgtcgcaggacgaggaatcggc
accttggtggtgtgcggttcgcaagggcagtcgcagcttttcgacgccggccaggcaccc
gccctgcccatgtcctgggagcgcttccgtccgaccttgcgcgcaggtcgccttttcacc
aagttcaccgaggcaaccggctattcgccagtcatgctgcccggcatgaccccttccacc
gtcgacccagaaatcgtggctgcagcagccaacgctggtcactgggcagagctcgcaggc
ggtggccagactaccaacgccttgctggcacgcaacttggagaagctagaggaactcctc
gagccaggcgtgaacgcacagttcaacgccatgtatctctccgcatcgcagtggcgccgc
cagatcgctggcgagcgcgccctacccaaggcacgcgcaaacggtgcgcccatcaacggc
gtggttgtctctgctggtatcccaccgctcgatgaggcagtggaactcgtagaatctctg
cacgcggacaacttcccgtgggtcgcattcaagccaggcaccatcaagcagatcgaccaa
gtactgcgcatcgccgagcaggccccaggacttatcatcatgcaggtcgaaggcggtcac
gccggtggccaccactcgtgggaggacctcgacgagctgctcgctgccacctatggtcgc
atccgcgagcacgacaacgtggtgctggccgtcggcggcggcatcggcaccccagcccgc
ggcgttcagtacctgctgggcacctgggcacacaagcaggggctgccggatgcgcctgtc
gacgccatcatggtgggcaccgccgccatggcgaccaaggaatccaccgcttccgaatcc
gtgaagcgcgcactcgtggccgcgcagccgaccgtccagaacgacggctgggccggcgtg
ggcgctgcagcccaggacttcggcggctccgtgacctccggactgtcccagctgggcgcg
gacatccacgagatcgacaactccttcgcacgcgccgggcgcctgctcgacgaggtcgcg
ggcgacgctgaggccgtggccgcacgtcgtgacgagatcatcgaggccatcggcaagacc
tgcaagccttacttcggcgaccttgactctatgacctacgcgcagtggctcgagcgctac
cttgagctttcctacatggggcagtgggtcgacgaatcctggttccagcgcttcgtcgcg
atggtggagcgcaccgaggcccgcctcaacccggcggaccacggcgagattgaacttcag
gtcaccgcagagcgcgagaacccggagcaggcagtcaagcagctgcgcgagctcctgggc
agcgccgccctcgaccagctcgtccacccaggcgacgccgcgtggttcctgcagctgctc
aaccagaagggcaagcccgccaacttcgtccccgtcatcgacgcggaggtccgccgtctg
tggcgccaggactccctgtggcaggcccacgacgagcgctacgacgccgaccaagtttgc
atcatcccaggcaccaccgcagtcggcggcatcgagcgcgctgacgagccggtggctgag
ctgcttgcccgcttcgagcaggccgcaacagatgagctgacccaggccggtgtacaagac
aaaccagagcactcggacttcgacacaatcctcaaggcaccaatggtcaattgggcaggc
cgcgagcagctcaacccgcttcgcctcgtgcttagcaccggccagttcctggctgagtcg
atcgagagcaaagacaacggctcccgctttcagaagcttgccgaaggcgagtactggctg
agcgtcccgctcaagggcgcgattgcaggcgcgcagctgcgcctgcgcatcaccccaccg
cagattccgggcgcctcgccgcttatcaccgaggccgatgccgctgagtccatgcgcgag
ctggctcgcgtcgccgcgggcggcaccctgccggaggtaaccggtggcaccgccatctgg
tccggcgagctcagcgccgcggattccgcggactatgaaaacgtcaccgcgggctatgca
cctgccgacgccctttccgcagacgttgccgagggcgcacacgtggccccagacgtcctc
gtgggcaaggcctggccagccgtgttcgcggtcatcgccaatgcagttaccgaagacgga
accaacgtcgttgaaggcctgctcaacctggtccacctggagcacaacctcgaactcaag
tccgcgctgccgcgcgaggcgaagctgcgcatcaccgccaccgcgggcgaggtccgcgac
accccagtcggccgcgtcgtcgacgtcgcagtagatattgagacggccaccgatggtgct
tccgtagctggtgcagacaccgcaggtaccccggttgcgcgcctcttcgagcgcttcgcc
atccaaggccgtcgcggcgagcaggaactcggcgcagcggactccgtcgcaggtgaagcg
tccaccactgcggaaaagccgcgcagcttccgccacgaaatgaccgtgaccgccccgcag
tcgatgcacccattcgccgtggtcacgggcgaccgcaaccccatccacgttgccgatctc
gccgcccagctggctggcctgaaggatggcgtcatcgtccacggcatgtggacctccgcg
ctggcgcagctggctgcagctttcgacggcgccgcagtccgtgagtggagcgccaccatg
caggcgcctgtcctgcccggcgcgcaggtcaccttcgtggtcgagcgcgtgggcctggac
acccgcccaggcttcggcgaggtccgagccgtcaccgcttccgtcgacggcgttccggtc
cttgaggctcgcgcaactgtcgctgacaagctgaccttctacggcttccccggccagggc
atccagtcgcaggggatgggcatggacgccttcgcggcgtcgtcaagcgcccgctccgtg
tgggaacgcgcggacaagcacacccgctccaagttgggattttccatcctggagatcgtg
cgcaacaatccgcagtccgtcactgtgcgcggcgaggagttcacgcacccggacggagct
cttttcctgacccagttcacgcaggtagccatggctaccctgggctgcgcgcagatcgcc
gagatgcaggaggccggcgtccttgactccggcgcctactttgcgggccactccgtgggc
gagtacaacgcccttgccgcctacgcgcaggtgctctccctcgaagcagtcgtggagatc
gtctacgcccgtggcctgaccatgcaccgcctggtcgagcgcgacgccgaggggaactcc
aactatggactggcggcgctgcgtccgaacaagatcggcgtctccgccaaggacgtgttc
ccgtacgttgctgagatttccgcgcagaccggcgagttcctggagatcgtcaactacaac
attgcaggcgtgcagtacgccgtcgccggtactcgcgcggggcttaacgccctgcgtgcc
gacgccgagcgccgcgcgccgggggcgcgtgccttcatccagatcccgggcatcgacgtg
ccgttccactcctctcatctgctgggcggcgtgcctgccttccgcgagcacctcgattcc
ctgattccggcggacatcgacctggatatcctcgtgggccactacgtgccgaacctggtc
gcgcgtccatttgagctcactgaagaattcgtgcaggccattgactccgtggtggactct
gagcccgtcaaggccatcctgtctgacttcgcgggcgcccttgagaacccggttcagttg
ggccgcaccttgctcattgagcttttggcctggcagttcgcttcacctgtccgatggatc
gaaacccaggatctcctgcttagcgagccgggcaccatcggcggcgctggcaccccgggc
ctgggcgtggggcgctttgtcgaggtgggcgtgggttcctcgccaacgctggcgaacatg
ctgggccagaccctgcgcctgccgcagtatgcaggccacggcatcgaggtgctcaacatc
gagcgcgaccgcgatgtcgtcttcgctgaggatgccatcgctcgcccggagccggagcag
actgcagcggctcaatctggtgccgagggtggtgctgtcgaatctgacgctaccgcagca
agcctggtccctgagacctcggcagcagcggagaccacgaccctcgtggctccggttccg
gcacctgctgcgggtggcgagaccccagcggataagccgttgagcgcgcagttcgccacc
gaaatgctcgtggcggtgtggaccaaggttcgcctggatcagatgggtcctgccgatacc
atcgaactgctcgtcgagggcgtgtcctcccgccgcaaccagctcctgctggatctgggg
gtggagttcggcctgggcgctatcgatggcgcggccgatgctgcgctgtcggaactcaag
gagactgtcgcaggcatggccaagggctataaggcctttggcccggtcctgggcgagcag
gtagctgatgcgctgcgccgccttactggacctgccggaaagaagcctggctacgtggct
gagcgcgtcaccggcgcctggggcttgggcgaaggctgggcagaccgcgtcatcgctgag
cttgtcctcggcactcgcgagggcgcgtccctacgcggcggcgacctggccacgctcggc
acgggcgctgcgaatgccaaggagctggatgcgcttatcgacgccgccgtgaccgccgcc
ggacagcgcgaggggattagcatcgcgatgccttccgcgggtggtgccgcgggcggtggg
gtagtggactccgcggctttggatgcctacaccgcggaaatgaccgatacccttgcagag
accgcccgcaccttgctgtccaagctgggagttgcggcgcctgccaccgagttctcggaa
gtagatgagaacgccgcactggcggagctagtctcccgtgagctgggctccgattgggcc
aagcaggtggcgccgtccttcgatgcggataaagcagtgcttcttgacgaccgctgggct
tctgcccgcgaggatcttgcgcgtgttgccgcgggcgagctcaacgctgcggacgtcgat
gttctgggcgctggcgaagccgtggcgcggctggcggagcactttgggctgccggatcac
gcgcaggaagcgcgtgtggatgccgctagcttgaccatgagcaacgacgttgccgtggtt
actggtggctccccgaactcgattgcggccgctatcatcggcgagctcctcaacgagggc
gccactgtggtggcaaccacctcgcgcctaaaccatgaccgcgtggagttctacaaggag
ctctaccgcacgcacgccgctggttccgccgcgttgtgggtggtccctgcgaacttgagc
tcctttaaagatctcgacgccttggtggagtggattggtaacgagcagacagccacagtg
ggtggcaagtccaagctggtcaagccggcgctggtgccgaccttgctcttcccgttcgct
gctccgcgcgtgcagggcacgctggccgacgccggcgcccaggccgagtcgcagatgcgt
ctgctgctgtggtcggtggagaagctcatcgcgggcctgtctcagctgggcgcggatacc
cacgtgggccagcgcctgcacgtggtgctgccaggcagcccgaaccgtggtcgcttcggt
ggcgacggcgcctatggtgaggccaaggcggcactcgacgccctggttacccgctggaag
gcagagcctgtctggggcgagcgcacctcgctggtccacgcccacattggttgggtacgt
ggcactggcctgatgggcggaaacgacccaatggtcgagcttgtcgaggccaagggcgtg
gaaacctactccaccgaggaaatggctatcaagctggtcgacggcggcgccaactccgat
gtgcgtgagcaggcggcccagggtccagtcacccttgacttcaccggcgggctgggcgag
gccgacctcaacctgcctgaactggcccgcgaggccacgcagcgtgcggagcaaacaagc
gcatccaatggcggcgtcatccgggccccgaagacggtgcaagcactgccgaacccgctg
tccccgttgcagtggaccacgccagacttcagcggcgtgacgcagtcgttcgatgacatg
gtcgtcatcgtcggcgcaggtgagctcggtccgctgggttcctcgcgtacccgcttcgag
gtcgagctctccggcgagctttccgctgccggcgtgcttgagctggcctggaccacgggc
cttatcaagtgggatgcgcagtcggcccagtggatcgttctggagaccggcgaagccatt
gccgaggaagacgtctacgaacagttccatgaccaagtgatggccaacatcggcgtgcgc
cgctaccacgatgacttcggcccgcacatgccgatggtggacaacctcgcacctgaattg
accaccatttacctggagaagccgctgaccttcaccgtggacgatgaagcaaccgccaag
tccttcgtagaagaagttgagggcgctacggcgcacttcgatggtgaggaatggcaggtt
acccgcccggccggctcgccagtgcgtgtgccgcgccgcgtggcaatgtcgcgcttcgtc
ggcggccaggtacccaccggattcgacccggcggtctatggcatcccggccgacatgatc
gacaacctcgaccgcgtggcgctgtggaacatcgtgtgcaccgtggatgcattcctctcg
gcgggcttcagcccggcagagctgctcgcgagcgttcaccccgcacgcgtgtcctcgacg
cagggcaccggcatgggcggcatggcctccctgcgctcgctctacgtggataagctgctg
gcgcagtcgcgcccgaacgacatcctgcaggaagccctgccgaatgtggtggcagcgcac
gtgatgcagtcctacgtgggcggctacggccagatggtccacccggttgcagcctgcgct
accgctgcggtctccgtggaggaagcgatggataagctgcgcctgcacaaggcagacttc
gtggtcgctggtggtatcgatgacttgtccatcgaaggcatcacaggcttcggagacatg
gcggccaccgcggattccgcggagatggaagccaagggaatcgaccacaagtacttctcc
cgcgcaaacgaccgacgccgtggcggcttcatcgagtctgaaggtggcggcaccctgctg
ttggcccgtggctcattcgccgcggagcagggactgccggttctgggcgtggtggccttc
gcggagtccttcgcggacggcgctcacacctccatccccgcgccgggattgggcgcgctg
tctgctgcccgtggcggcgtggattcccgcttggcgcaggccctgcgtgctcatggcgtc
acgccggatgaggtgtccatcatctccaagcacgacacctcgactaatgcgaatgacccg
aacgagtcggatctacacgagcgcattgctgccgcgatgggacgcaatagcggcaacccg
atgtacgtgatttcgcagaagaccctgactggccacgccaagggtggtgccgccgcgttc
cagatggttggcctgacgcaggtcctgcgtgagggcatcctgccgccgaaccgctccctg
gattgcgtggacccggtgctggctaagcatgagcacctggtttggctacgtcatcagctg
gacctgcgcggaaaccaggcaaaagcgccgaaggctggccttgttacttcgctgggattc
ggccacgtctccgctctggtggcggtggtgcaccccggtgcgttcttggtggcattggct
gcggcgcgcggtagcgatgcggcaacacggtgggaagcgcgagctcaggcacgtgagcgc
gccgggctgcgtcgtattgagtccgccatgcgcggtggggcagcgctctatgagcgcccc
gtcgaccgcaacctgggcgggactggtgacgccgtgaaggaacgagaagcccgtgtcctc
cttgatgacagcgcacgcttgcagggtggtgtgcttagcctcgggaaaggataa

DBGET integrated database retrieval system