KEGG   Corynebacterium sphenisci: CSPHI_01020Help
Entry
CSPHI_01020       CDS       T05122                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
csph  Corynebacterium sphenisci
Pathway
csph00020  Citrate cycle (TCA cycle)
csph00190  Oxidative phosphorylation
csph00650  Butanoate metabolism
csph01100  Metabolic pathways
csph01110  Biosynthesis of secondary metabolites
csph01120  Microbial metabolism in diverse environments
csph01130  Biosynthesis of antibiotics
csph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSPHI_01020 (sdhA)
   00650 Butanoate metabolism
    CSPHI_01020 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CSPHI_01020 (sdhA)
Enzymes [BR:csph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CSPHI_01020 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CSPHI_01020 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C NAD_binding_8 Pyr_redox_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: APT89902
UniProt: A0A1L7CVM2
LinkDB All DBs
Position
229221..231233
Genome map
AA seq 670 aa AA seqDB search
MTAEALIKEFQAPASCVEGVKIGDVIGDNSPGDKVSQREHWNYQKDHYNLVSPLNRKKFR
ILVIGTGLAAGAAAAALGELGYDVKAFTYHDAPRRAHSIAAQGGVNSARGKKVDNDGAYR
HVKDTVKGGDFRCRENDCWRLADESVRVIDHLNAIGAPFAREYGGALATRSFGGVQVSRT
YYTRGQTGQQLQLSTSSALQRQVGLGNVELFTHNEMVDIIVADGRCQGAVMRNLITGELT
VHTAHAVVLGTGGYGNVYHMSTLAKNSNASAIMRAYDQGAYFASPSFIQFHPTGLPVNAY
WQSKTILMSESLRNDARIWTPKKKGDDRPANDIPEDERDYFLERRYPAFGNLVPRDVASR
ANAQQINAGYGVGPLKNSVYLDLLDAIRELGKDTIKERYSNLIQMYEEAIGDDAYEVPMR
IAPTCHFTMGGLWSDFDQMTSIPGLFTGGECSWTYHGANRLGANSLLSASVDGWFTLPFS
VPNYLGPLLGTDRLPEDAPEALEAVERVRTRLDKLMSIGGSHGAEYFHRQLGEELYRVCG
VARNTKDLAEGLQNIRKLREEFWADLFIPGNPDEMNQQLEYANRVADYLDLGELMCVDAL
DRDESCGAHYRDDHIDEEGEAERDDANWCFVSAWQRGDNGPAWDLKSHEFIRHAEPLSFE
AVPLMTRNYK
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagaagcactcatcaaggagttccaggccccggcctcgtgcgtggagggcgtc
aagatcggcgacgtcatcggggacaacagccccggcgacaaggtctcccagcgcgagcac
tggaactaccagaaggaccactacaacctcgtctcgccgctgaaccggaagaagttccgg
atcctggtcatcggcaccggcctggccgccggcgcggccgccgccgccctcggcgagctg
ggctacgacgtgaaggcgttcacctaccatgacgccccgcgccgggcgcactccatcgcc
gcccagggcggcgtgaactccgcccgcggcaagaaggtggacaacgacggcgcctaccgg
cacgtcaaggacaccgtcaagggcggcgacttccgctgccgggagaacgactgctggcgg
ctggccgacgagtcggtgcgcgtcatcgaccacctcaacgcgatcggcgcccccttcgcc
cgcgagtacggcggcgccctggccacccgctccttcggcggcgtgcaggtctcccgcacc
tactacacccgcggccagaccgggcagcagctgcagctgtccacctcctcggcgctgcag
cgccaggtgggcctgggcaacgtggagctgttcacccacaacgagatggtggacatcatc
gtcgccgacggccgctgccagggcgcggtgatgcgcaacctgatcaccggcgagctcacc
gtgcacaccgcgcatgcggtggtgctgggcaccggcgggtacggcaacgtgtaccacatg
tccaccctggcgaagaactccaacgcctcggcgatcatgcgggcctacgaccagggcgcc
tacttcgcctccccgtcgttcatccagttccaccccaccggcctgccggtgaacgcgtac
tggcagtccaagaccatcctcatgtcggagtcgctgcgcaacgacgcgcggatctggacc
ccgaagaagaagggcgacgaccgcccggccaacgacatccccgaggacgagcgggactac
ttcctggagcgccgctacccggccttcggcaacctggtgccccgcgacgtggcctcccgc
gccaacgcgcagcagatcaacgccggctacggcgtcggcccgctgaagaactcggtgtac
ctggacctgctggacgcgatccgggagctgggcaaggacaccatcaaggagcgctactcc
aacctcatccagatgtacgaggaggccatcggcgacgacgcctacgaggtgccgatgcgc
atcgccccgacctgccacttcaccatgggcgggctgtggagcgacttcgaccagatgacc
tccatccccggcctgttcaccggcggggagtgctcctggacctaccacggcgccaaccgg
ctgggcgcgaactcgctgctctcggcctccgtggacggctggttcacgctgcccttctcg
gtgccgaactacctcggcccgctgctgggcaccgaccggctgcccgaggacgcccccgag
gccctggaggccgtggagcgggtgcgcacccgcctggacaagctgatgtccatcggcggc
agccacggcgccgagtacttccaccgccagctcggcgaggagctgtaccgggtgtgcggc
gtggcccgcaacaccaaggacctcgccgagggcctgcagaacatccgcaagctgcgcgag
gagttctgggcggacctgttcatcccgggcaaccccgacgagatgaaccagcagctggag
tacgccaaccgggtcgcggactacctcgacctgggtgagctcatgtgcgtcgacgccctg
gaccgggacgagtcctgcggcgcgcactaccgcgacgatcacatcgacgaggagggcgag
gccgagcgcgacgacgccaactggtgcttcgtctccgcctggcagcgcggcgacaacggc
cccgcctgggacctgaagtcgcatgagttcatccgccacgccgaacccctcagcttcgag
gccgtcccgctcatgacaaggaactacaagtaa

DBGET integrated database retrieval system