KEGG   Corynebacterium sphenisci: CSPHI_01025Help
Entry
CSPHI_01025       CDS       T05122                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
csph  Corynebacterium sphenisci
Pathway
csph00020  Citrate cycle (TCA cycle)
csph00190  Oxidative phosphorylation
csph00650  Butanoate metabolism
csph01100  Metabolic pathways
csph01110  Biosynthesis of secondary metabolites
csph01120  Microbial metabolism in diverse environments
csph01130  Biosynthesis of antibiotics
csph01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSPHI_01025
   00650 Butanoate metabolism
    CSPHI_01025
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CSPHI_01025
Enzymes [BR:csph01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CSPHI_01025
    1.3.5.4  fumarate reductase (quinol)
     CSPHI_01025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_7 Fer4_8 Fer4_10 Fer4_17 Fer4 Fer4_18 Fer4_9 Fer4_15 Fer4_4 Fer4_2 Fer4_6 Fer4_16 Fer4_21 Fer4_3 Fer4_22 Fer2 Fer4_13
Motif
Other DBs
NCBI-ProteinID: APT89903
UniProt: A0A1L7CVN2
LinkDB All DBs
Position
231233..231982
Genome map
AA seq 249 aa AA seqDB search
MKLHLEIWRQAGPQTEGHFETVDVDDAVPEMSILELLDHVNSKYVEAGKEPFAFASDCRE
GICGTCGLNVNGRPHGPGKNTPACQQRLHQFDDGDSLKIEPMRSAAYPVIRDMVVDRSAL
DRVMEKGGYVSVAAGTAPDADTLHVNHETAELALDHAACIGCGACVAACPNGAAHLFTGA
KLVHLSLLPMGKQERGLRARKMVDQLETTFGPCSLFGECAEVCPAGIPLTAVASISKERA
RSAFRGKDD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcatcttgagatctggcgtcaggccggcccgcagacggaggggcacttcgag
accgtcgacgttgacgacgcggtcccggagatgtccatcctggagctgcttgaccacgtc
aactccaagtacgtggaggcgggcaaggagcccttcgccttcgcctccgactgccgtgag
ggcatctgcggcacctgcgggctcaacgtcaacgggcgcccgcatggcccgggcaagaac
accccggcctgccagcagcggctgcaccagttcgacgacggcgattcgctgaagatcgag
ccgatgcgctccgccgcctacccggtgatccgggacatggtggtggaccgctccgccctg
gaccgggtgatggagaagggcggctacgtctccgtggccgccggcaccgccccggacgcg
gacaccctgcacgtcaaccacgagaccgccgagctcgccctcgaccacgcggcctgcatc
ggctgcggcgcctgcgtcgcggcctgccccaacggcgcggcgcacctgttcaccggcgcg
aagctggtgcacctgtcgctgctgccgatgggcaagcaggagcgcgggctgcgcgcccgg
aagatggtggaccagctggagaccaccttcggcccctgctcgctgttcggcgagtgcgcc
gaggtctgcccggccggcatcccgctgaccgccgtcgcctccatctccaaggagcgggcg
cgttcggcattccggggcaaagacgactag

DBGET integrated database retrieval system