KEGG   Corynebacterium sphenisci: CSPHI_01440Help
Entry
CSPHI_01440       CDS       T05122                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
csph  Corynebacterium sphenisci
Brite
KEGG Orthology (KO) [BR:csph00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:csph03012]
    CSPHI_01440
   03029 Mitochondrial biogenesis [BR:csph03029]
    CSPHI_01440
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csph04147]
    CSPHI_01440
Translation factors [BR:csph03012]
 Eukaryotic Type
  Elongation factors
   CSPHI_01440
 Prokaryotic Type
   CSPHI_01440
Mitochondrial biogenesis [BR:csph03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CSPHI_01440
Exosome [BR:csph04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CSPHI_01440
  Exosomal proteins of breast cancer cells
   CSPHI_01440
  Exosomal proteins of colorectal cancer cells
   CSPHI_01440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: APT89968
UniProt: A0A1L7CVX6
LinkDB All DBs
Position
321864..323054
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTTTAAITKVLAEEFPELNQAFAFDAIDKAPEEKE
RGITINVSHVEYQTDKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEDAPIVHISALKAL
EGDPEWTKSIVELMNACDEKIPDPVRETDKPFLMPIEDIFTITGRGTVATGRVERGTLNV
NDEVEILGIREKSQKTTVTGIEMFRKLLDSAEAGDNCGLLLRGIKREDIERGQIIAKPGA
YTPHTEFEGSVYILSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVKLPEGTEMVMPGDNVD
MSVTLIQPVAMDEGLRFAIREGGRTVGAGRVTKINK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaggcgaagttcgagcgtacgaagccgcacgtcaacatcggcaccatcggtcac
gtcgaccatggcaagaccaccaccaccgccgccatcaccaaggttctggcggaggagttc
ccggagctcaaccaggccttcgccttcgacgccatcgacaaggcgccggaggagaaggag
cgtggcatcaccatcaacgtgtcccacgtggagtaccagaccgataagcggcactacgcc
cacgtcgacgccccgggtcacgccgactacatcaagaacatgatcaccggcgccgcccag
atggacggcgcgatcctggtggtcgccgccaccgacggcccgatgccgcagacccgcgag
cacgtgctgctggcccgccaggtcggcgtcccctacatcctggtcgcgctgaacaagtgc
gacatggtggatgacgaggagatcatcgagctcgtcgagatggaggtccgcgagctcctc
gccgagcaggactacgacgaggacgccccgatcgtgcacatctccgcgctgaaggcgctg
gagggcgacccggagtggaccaagtccatcgtcgagctgatgaacgcctgcgacgagaag
atcccggatccggtccgcgagaccgacaagccgttcctgatgccgatcgaggacatcttc
accatcaccggccgcggcaccgtcgccaccggtcgcgtggagcgcggcaccctgaacgtc
aacgacgaggtcgagatcctgggcatccgcgagaagtcccagaagaccaccgtcaccggc
atcgagatgttccgcaagctgctggactccgccgaggccggcgacaactgcggtctgctg
ctgcgcggcatcaagcgcgaggacatcgagcgcggccagatcatcgccaagccgggcgcg
tacaccccgcacaccgagttcgagggctccgtgtacatcctgtccaaggacgagggcggc
cggcacaccccgttcttcgacaactaccgcccgcagttctacttccggaccaccgacgtc
accggcgtcgtgaagctgccggagggcaccgagatggtcatgcccggcgacaacgtcgac
atgtccgtcaccctgatccagccggtcgcgatggacgagggcctgcgcttcgccatccgc
gagggtggccgcaccgtcggcgccggccgcgtcaccaagatcaacaagtag

DBGET integrated database retrieval system