KEGG   Corynebacterium sphenisci: CSPHI_06385Help
Entry
CSPHI_06385       CDS       T05122                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csph  Corynebacterium sphenisci
Pathway
csph00620  Pyruvate metabolism
csph00680  Methane metabolism
csph01100  Metabolic pathways
csph01120  Microbial metabolism in diverse environments
csph01200  Carbon metabolism
Module
csph_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:csph00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSPHI_06385
  09102 Energy metabolism
   00680 Methane metabolism
    CSPHI_06385
Enzymes [BR:csph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CSPHI_06385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APT90733
UniProt: A0A1L7CY60
LinkDB All DBs
Position
1344308..1347094
Genome map
AA seq 928 aa AA seqDB search
MNVSHSAAGADDLLREDIRHLGRILGEVIREQEGDEVFGLVESARRTAFRLHRGEGGIGE
LTGLFRDIDPDDASPVIRAFTHFALLANLAEDLHEERLLDRALDAGRPAPDSSLDATWAK
LAAAGEDAAAAAAGLLAGGEVVPVLTAHPTETRRRTVFDAQKHIAAAMRARHRVQAAPAT
ARTAARLAELDLEIRRRVITLWQTALIRVNRPDIRDEIEVGLRYYQLSLLETVPAVNREV
RRGLRRAAGDAAAAAPARPMLRMGSWIGADHDGNPYVTAGTIEYAADRAAGTILRHYLDE
LADLERELSLSDRLGTVSVDLVALAAAGRNDIPSRVDEPYRRAVHGIRGRIAATAEQLLG
TAASAEAAGFEPYPDAAAFRAELDVVEASLRAGRDDLIADHRLARLQDAVDAFGFHLHSL
DLRQNSESHEAILAELFALAGVHPDYAGLDEDDRVALLTRELSTARPLVPREAELSEATA
RELGIVRAAAAAARAYGAEMVPRSIISMCASVSDLLEPMILLKEAGLITVGPEGPAGAVD
VIPLFETIEDLRAGAEVLRAAWALPLYRGYVAGRGDLQEVMLGYSDSNKDGGYFAANWAL
YDAELRLSAVSAEHGIALRLFHGRGGTVGRGGGPSYEAILAQPPGAVGGRVRITEQGEII
SAKYGHPEAARRNLEALVAATIEATALGVGEPPHPERAHAVMAEIAELSRTAYASLMHED
PGFIEFFETSTPVAEIGALNIGSRPSSRKQTSSISDLRAIPWVLSWSQQRSMVPGWFGVG
SALRDWLGEDPDGARLAELRGLYRDWPFFASVLSNMAQVMAKADMDLAGLYADLVADREV
AERIRGRLRAEFELTREMFLAVTGQSGLLDDNPLLARSVDMRFPYLMPLNVIQLEMLRRY
RAGDNRDRVHRGIQLTMNGLATALRNSG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttagccacagcgccgccggcgccgatgatctgctccgcgaggacatccggcac
ctgggccggatcctgggggaggtaatccgcgagcaggagggcgacgaggtcttcggcctc
gtcgaatccgcccgccgcaccgccttccggctgcaccgcggcgagggcgggatcggggag
ctcaccgggctgttccgggacatcgaccccgatgacgcctccccggtgatccgcgccttc
acccatttcgcgctgctcgccaacctcgccgaggacctgcacgaggagcggctgctggac
cgggccctcgacgccggccggcccgccccggactcctccctggacgccacctgggcgaag
ctcgccgccgccggggaggacgcggcggcggcggccgccgggctgctcgccggcggggag
gtggtgccggtgctcaccgcccatcccacggagacccgccggcgcaccgtcttcgacgcg
cagaagcacatcgccgcggcgatgcgcgcccggcaccgggtgcaggccgccccggccacc
gcccgcaccgccgcccggctggcggagctggacctggagatccggcgccgggtgatcacc
ctgtggcagaccgcgctcatccgggtcaaccggcccgacatccgcgacgagatcgaggtg
ggcctgcgctactaccagctctccctgctggagaccgtgcccgcggtgaaccgggaggtg
cgccggggcctgcgccgcgccgccggcgatgccgccgcggcggcgccggcccggccgatg
ctgcggatgggctcctggatcggcgccgaccacgacggcaacccctacgtcaccgccggc
accatcgaatacgccgcggaccgggccgccggcaccatcctgcggcattacctcgacgag
ctcgccgacctggagcgggagctgtccctctccgaccggctgggcaccgtcagcgtggac
ctggtggccctggccgccgccggccgcaacgacatccccagccgggtcgacgagccctac
cggcgcgccgtgcacggcatccggggccggatcgcggccaccgccgagcagctgctcggc
accgccgcctccgccgaggcggccggtttcgagccctacccggatgcggcggccttccgc
gccgaactcgacgtggtggaggcctcgctgcgcgccggccgggacgacctcatcgccgac
caccggctggcccggctgcaggacgccgtggacgccttcggcttccacctgcactccctg
gacctgcgccagaactccgagtcccatgaggcgatcctcgccgagctcttcgccctcgcc
ggggtgcacccggactacgcgggcctcgacgaggacgaccgggtggccctgctcacccgg
gagctgtccaccgcccggcccctggtgccgcgcgaggccgagctcagcgaggccaccgcc
cgggagctcggcatcgtccgggccgccgcggccgccgcccgcgcctacggggcggagatg
gtgccccggtcgatcatctccatgtgcgcctcggtctccgatctgctggagccgatgatc
ctgctcaaggaggccgggctcatcaccgtcggccccgaggggccggccggggcggtggac
gtgatcccgctgttcgagacgatcgaggatctgcgggccggggcggaggtgctccgcgcc
gcctgggcgctgccgctctaccggggctacgtcgccgggcgcggggatctgcaggaggtg
atgctcggctactccgactccaacaaggacggcggctacttcgcggcgaactgggcgctc
tacgacgcggagctgaggctcagcgcggtctccgccgagcacggcatcgcgctgcggctc
ttccacggccgcggcggcaccgtgggccgcggcggcgggccctcctacgaggcgatcctg
gcccagcccccgggggcggtcggcggccgggtgcggatcaccgagcagggcgagatcatc
tccgccaagtacggccaccccgaagccgcccggcgcaacctggaggccctggtcgccgcg
accatcgaggccaccgccctcggcgtcggggagcccccgcacccggagcgggcgcatgcc
gtgatggcggagatcgcggagctgtcccgcaccgcctacgcctcgctcatgcacgaggac
cccgggttcatcgagttcttcgagacctccaccccggtcgccgagatcggggcgctcaac
atcggctcccggccctcctcgcgcaagcagacctcctccatctcggatctgcgggcgatc
ccctgggtgctgtcctggtcccagcagcgctccatggtgcccggctggttcggggtgggc
tccgcgctgcgggactggctgggcgaggaccccgacggcgcccggctggcggagctgcgc
gggctgtaccgggactggcccttcttcgcctcggtgctgtccaatatggcgcaggtgatg
gcgaaggcggacatggatctcgccgggctctacgccgacctggtcgccgaccgggaggtc
gccgagcggatccggggccggctgcgcgccgagttcgagctcacccgggagatgttcctc
gccgtcaccggccagtccgggctgctcgacgacaatccgctgctggcccgctcggtggac
atgcgcttcccctacctgatgccgttgaacgtgatccagctggagatgctgcgccgctac
cgggccggggacaaccgggaccgggtgcaccggggcatccagctgaccatgaacgggctg
gccaccgcgctgcgcaactccggctag

DBGET integrated database retrieval system